SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA001812-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA001812-PA
Domain Number 1 Region: 87-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000965
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 2 Region: 211-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000191
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 3 Region: 26-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000025
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 4 Region: 172-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000786
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 250-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000214
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 6 Region: 291-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000255
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 132-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000119
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  MESCA001812-PA
Domain Number - Region: 60-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0147
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MESCA001812-PA
Sequence length 343
Comment pep:novel scaffold:Msca1:scaffold31392:6499:7969:-1 gene:MESCA001812 transcript:MESCA001812-RA description:""
Sequence
MYQDSIQPRPQFKLNGPKVEEGCVLCFQEDCQNGGKCTNSSEQYACTCMPGFEGDDCSTD
IDECLTAQCTNNSTCIDEIAGSHAILCEHEIDECESNPCQNGGICTDLRAAYKCDCAEEY
AGPQCDVLKLVNCDSDPNPCKKGSCVDGYNATTGNNFTCNCMTGYQGPMCDVPFCFIEEC
KNGGLCLNSKPLQPPICQCSIGYEGEYCEIDINECEPNPCQNGGQCIDEVGAYKCNCTGT
GFEGPQCENDIDECNIGRTKCGGKGACINLPGSFKCECALGLCGYDCHLDDPCIMKESGV
CDNGGSCVEKCTDVVDYTCNCTIGFMGKTCNQMARKQRKEELH
Download sequence
Identical sequences T1GEP2
MESCA001812-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]