SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA002363-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA002363-PA
Domain Number 1 Region: 41-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000381
Family I set domains 0.05
Further Details:      
 
Domain Number 2 Region: 182-245
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000328
Family V set domains (antibody variable domain-like) 0.078
Further Details:      
 
Domain Number 3 Region: 129-175
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000655
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MESCA002363-PA
Sequence length 264
Comment pep:novel scaffold:Msca1:scaffold37829:6752:14735:-1 gene:MESCA002363 transcript:MESCA002363-RA description:""
Sequence
MAGFTGYECKEVEGRPIQPSYTTNAPQTQPPYVPYPDEIVYINPKYVDDSVGSNIKLTCQ
SAQPQQFAYIWYKDNRNVEMGRHIFAYENVLIIRTAAVEDSGEYKCEARNNENVFTSTVV
VNIRSEENSFRNIETYGNILRINSINPANEGKYFCNASNLFGEAMKETSVHIEKRGLYTQ
REQAYAGDTVELQCDHRYTGNYGYKWRTENYNLLDNYIDVSQSTLRLENVQLSDAGRYFC
DVYSLDNKVVSSQAIELEIHRKYR
Download sequence
Identical sequences T1GG54
MESCA002363-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]