SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA002381-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA002381-PA
Domain Number 1 Region: 97-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000432
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 2 Region: 56-94
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000107
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 280-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000289
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 4 Region: 6-45
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000913
Family V set domains (antibody variable domain-like) 0.089
Further Details:      
 
Weak hits

Sequence:  MESCA002381-PA
Domain Number - Region: 576-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00114
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 227-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family EGF-type module 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MESCA002381-PA
Sequence length 630
Comment pep:novel scaffold:Msca1:scaffold9411:2765:5316:-1 gene:MESCA002381 transcript:MESCA002381-RA description:""
Sequence
GASDVNGRLEIPNIRIEDSGDYVCQAIGFSNHIPGQSVHVSLIVEQHKFIPETHVFCNAY
NESTCMDGITCIDRNFICDGRPQCPDSSDEFSCSINKKCQPNQFMCRNGKCVAKFWRCDG
ENDCGDNSDEESCGQTPVSGPCKNSADVILVGKRYSLFYYNNELPSSISVLLYPGKLLKA
NNMPATTEEVIYTLSELTNILVKISYSRQTNVILSEMSINSADTNVFKELCSCPPGYSGS
SCEKCEPGYSKNRNGKCIAVQECPAGTYGDLTRDIPCTECACPGNGRNYADGCRLDDYGQ
VVCNCRRGYTGRRCEICDSGYIGNPLNGIECEIPRSQCNMDGTLRINPDEGAKCDRCKPS
SFFLNSNSESGCINCFCSGVSSECRSSSLYRDTIYSRGSNLNDIKLSTFLADGITTHYNS
VQSVLRGAELTHSRDTNDLLYWKLPDLFLNNKVKSYGGFLNYTLRYAPSQGGAMSKNAAA
DVIIKSANEIEIQHFRRTPLSAGQSSSYSIPLFEQLWQRKDRVVINREYFLMALSNIEAI
YIKATYTTTTSEVVLNEVSMDIAIENFTGREQAYEVEECVCPEEYVGLSCEYCAPGYTRN
YESGLYLGSCEPCSCNGNSNECDSETGVCQ
Download sequence
Identical sequences T1GG71
MESCA002381-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]