SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA002429-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA002429-PA
Domain Number 1 Region: 70-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000181
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 2 Region: 112-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000329
Family EGF-type module 0.006
Further Details:      
 
Domain Number 3 Region: 151-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000823
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 4 Region: 3-45
Classification Level Classification E-value
Superfamily L domain-like 0.00000416
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA002429-PA
Sequence length 185
Comment pep:novel scaffold:Msca1:scaffold7307:1999:3622:1 gene:MESCA002429 transcript:MESCA002429-RA description:""
Sequence
EDLKSINNIALGNNPLYCDCSLKWLSDWIKLDYVEHGIARCVEPESMNGKLILSTPSHYF
VCKEKIRHEILSKCNACYTTPCQNNAECVPLPQRDYKCQCQPGYHGRHCEYMIDACYGNP
CRNNATCTVLEEGRFSCQCEPGYSGARCEINIDDCMDNKCQNNATCVDGVQSYTCNCQPG
FSDEI
Download sequence
Identical sequences T1GGB5
MESCA002429-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]