SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA002715-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MESCA002715-PA
Domain Number - Region: 386-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000371
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA002715-PA
Sequence length 635
Comment pep:novel scaffold:Msca1:scaffold52700:6482:9050:-1 gene:MESCA002715 transcript:MESCA002715-RA description:""
Sequence
MRAKGSRLAFSSALASERNWTNPNNERIEQQGLAFTKSCITKLKSELFVNTIDPIFLTNS
KEVRNTLNDQKGNQNNIYSILIPEKVEKATIRILFLKPINDTPLLKVFIKSKSTPTNLNY
KYMFKLDPRNYTQSDFNISVISNAWHFITVEASTKNSSFEVQYSINISFTQSAENIIENE
FGYRMVRFQDIDFYETKRVNQMDFFLFDVEIFNSNGSSTDFFNLTSGINYGFRFHVYDCQ
DIGGTLTSLISLVNSDENIVFNKASDRMAEGPDIIFEQSSIKPEKLVLKSPDRISEQNLT
VIKIAIICMNLEEPGIPELPGKCRYGNTFHNASAIVKTGEWFLTIQVFCIIDQKGKSLTD
LLVESYSNENEVDECNGTFIISISSMPCGPNQCGSFGSCYHYMSGGFVYTTCVCRNGYRG
WDCSDDSDVHSLGLILFSILLLTLSNLLFIPSVYLAIKRQYFTEAFIYFCSMFFSSFYHA
CDSGEDVYSFCLVRLSVLQFCDFYCGLLSIWVTLIAMANLRIKYVSLAHMIGAIGLAFGT
EYDKQSLTVFLAPALIGICIISICWIYKCKKTKALYPSKKYLTIWLPIGAVLVMFGLICY
AFLQTKQNYHIIHSIWHVVMAISILCLLPNRKIYL
Download sequence
Identical sequences T1GH31
MESCA002715-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]