SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA002956-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA002956-PA
Domain Number 1 Region: 347-370
Classification Level Classification E-value
Superfamily DPY module 0.000000353
Family DPY module 0.0011
Further Details:      
 
Domain Number 2 Region: 450-473
Classification Level Classification E-value
Superfamily DPY module 0.00000288
Family DPY module 0.0019
Further Details:      
 
Domain Number 3 Region: 555-578
Classification Level Classification E-value
Superfamily DPY module 0.0000051
Family DPY module 0.0021
Further Details:      
 
Domain Number 4 Region: 356-506
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000251
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 46-69
Classification Level Classification E-value
Superfamily DPY module 0.0000405
Family DPY module 0.0024
Further Details:      
 
Weak hits

Sequence:  MESCA002956-PA
Domain Number - Region: 146-168
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 10-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00185
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 106-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0227
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 515-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0778
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 209-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MESCA002956-PA
Sequence length 649
Comment pep:novel scaffold:Msca1:scaffold29606:1632:10097:1 gene:MESCA002956 transcript:MESCA002956-RA description:""
Sequence
TQVVLHDIKNPCYPNPCGPNSQCNVRGNDYICRCINDFIGTPPNCRPECVHNFDCKPELA
CIKNRCSDPCRANKLCGYRSTCSVRDHNPVCSCVEGSYGNPYIRNSEKDKCQPNPCGPFS
ICHSSSERISCECVNNAIGSPPNCRIECSSNNDCPLDKLCQNNKCVDPCSVCGYNAHCNV
RNHSPLCYCFDNYVGNPYIGCLLQETRVENKNPCDPSPCGPFSFCKIENNSPVCSCLENY
FGNPPYCKPECLVNSDCRQTEIVKTKSVNEICGLRATCYVRKHIASCLCNDGFTGNPFIE
CTLIRRAEIQNIKRSCECGINAECKDSSLGSCKCIENYFGNPYEICRPECIINSDCPTNL
ACLQNKCQDPCKSLCGSLSHCVVTNHNPVCLCNPGYTGNPYDYCKIERNIVEQNPCNPSP
CGPNSQCRLQQGNAVCNCLPYFIGNPPYCKPECVSNSECSLNKACKNNKCIDPCQSCGEN
TVCIVRYHSPICSCKEGYTGDALSTCFVVINIDVDYKKTPCNPSPCGPNSSCRNSNDQEI
CSCAEGYFGSPPFCRPECTTNSECSYDKSCINNKCENPCTDTCGLNAECFVRSHLPICKC
KSGFNGNPYDRCEVKPTQLYNENENPCLPSPAVQIPNAMLLEILHPARA
Download sequence
Identical sequences T1GHP8
MESCA002956-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]