SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA003238-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA003238-PA
Domain Number 1 Region: 182-319
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.93e-21
Family Laminin G-like module 0.0082
Further Details:      
 
Domain Number 2 Region: 124-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 86-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000101
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  MESCA003238-PA
Domain Number - Region: 66-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00159
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA003238-PA
Sequence length 341
Comment pep:novel scaffold:Msca1:scaffold6432:27290:28372:1 gene:MESCA003238 transcript:MESCA003238-RA description:""
Sequence
MSRKNMAINKLLQTGDKQVIVGYSPCSQLNVCSNGGVCHEDFYVDVDMKLSIIESESLII
TSPYVQHRAICKCSDGYTGNNCEKRQDPCSPNPCKAEGLCRRFGHDFQCQCPPHREGKIC
QLEKEDVCLGNPCKNGGSCRESPDGSSFFCLCRPGYRGNQCEHIADSCRPNPCLHDGICI
SATPGYKCSCVGGRYGRHCEKTTYGFQELSFMSFPPLDAATNDISIVFATTKPDALLLYN
YGVQTGGRSDFVAIELLKGRAYFSFGGARTAITTIVVGGGGSNNQLESISNGKWHKITAT
RNGKVMSLSVSKCIENEMFVRNADLGIVHAMLKTLVQLDWA
Download sequence
Identical sequences T1GIG0
MESCA003238-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]