SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA003239-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MESCA003239-PA
Domain Number - Region: 11-72
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000129
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number - Region: 91-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0628
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA003239-PA
Sequence length 188
Comment pep:novel scaffold:Msca1:scaffold6432:29719:30448:1 gene:MESCA003239 transcript:MESCA003239-RA description:""
Sequence
MPMPLDVYHMTLNFNKEPLMIGGLSSADPILERPGQLHSDDLVGCVHSVSINGRFLNLSN
PIEQNAILPTCNRNNNGGPCSEGLPEDPTLSLCGNYGTCYDRWHTAQCRCGGDLFSPDCY
NSIEPISLSDGGFMNSLYPRNIDGCNYWIIYIRAKMLGVMMIYLGNDVIQLHTIILVCWH
KQKILQNH
Download sequence
Identical sequences T1GIG1
MESCA003239-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]