SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA003447-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA003447-PA
Domain Number 1 Region: 179-303
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000392
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 2 Region: 93-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000718
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 3 Region: 55-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000542
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 136-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000679
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MESCA003447-PA
Sequence length 528
Comment pep:novel scaffold:Msca1:scaffold7496:4006:5704:1 gene:MESCA003447 transcript:MESCA003447-RA description:""
Sequence
MKIPNNLLHCKPGWKGALCDECETHPSCLRGYCTLPGTCICNEGWGGQFCNQDLIYCTHH
KPCKNNGTCFNTGEGYYTCKCEPGYFGDNCENEITTCMDNPCANNGKCIDEISKNTYRCE
CPPGWKGKNCQQQIITCSEKPCMNNGKCLPRNNGFHCDCTQGFGGQTSRNSTGGYRCDCI
GDYIGDRCELYDLCATNPCENGGTCLLKGNQFQCKCKPGFIGSMCSDEVNLCIAKPCANG
GTCRNLDNDYQCTCRSGFTGKDCSIDIDECSSAPCKNGGTCVNRINSFECLCPHGYEGKE
CEFESYSASYGAQLYDTQSSSMNKDDGLSSGQVVLIAILSVAMPVVAVIAACVVVCIKRK
RKRDQDKHDAEARKQNEQNATAHHHIHTHRGSNSGLPFDNSNPNIIKNTWDKSVNNMSSS
NASVEDTLLNSSLYGAGTYSDNNNANGEAFMVVPSLQRVKSQKQLNTDPTLMHNHRASQM
LSQQQSQQAHLMDSKRLSVWVVWVMVSNVTNSNNNSGGVNKMEPLAVV
Download sequence
Identical sequences T1GJ08
MESCA003447-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]