SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA003483-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA003483-PA
Domain Number 1 Region: 18-228
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-27
Family YWTD domain 0.00017
Further Details:      
 
Domain Number 2 Region: 522-561
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 362-407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 316-361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 474-507
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 6 Region: 282-318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 405-442
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000314
Family LDL receptor-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  MESCA003483-PA
Domain Number - Region: 450-475
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000327
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number - Region: 240-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000381
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MESCA003483-PA
Sequence length 570
Comment pep:novel scaffold:Msca1:scaffold46406:84:7776:1 gene:MESCA003483 transcript:MESCA003483-RA description:""
Sequence
MRLDKENGKKCIPVDQVLLFVMENQIRGIDLQQPNHHIIPTISQSSQGLGPYNIDFIVAK
NQIYWSDVFLNEVKTAKLDSGKIETVMNTDLIKPYGFAVDWIANNIYVSSGNQKCNIYAT
GLDGQFVTLIHKDLGSVKSIVLDPANGVMYWAEQELQSNRSKCNYDGTNRVILSNMVPKH
PFSMAIYGDLIFWTDWVLHAVLRANKYTGSDVIVLRNDIERPMGVSAIQSITQNCASNEC
KILNGGCEDVCLLNKDGTASCKCSRGYLAKDGRRCLDRNKETNCTLDQFRCTNGECIPFF
LTCDGLPHCSDESDEDIHYCAIRECPKNFFMCNNHRCIPFNETCDGETQCGDWSDEGDTV
CKCEGEKFQCKSGQCIPNKYVCDGITHCKDGTDEWNCTHKECPTGDAQYIHCENTTGCYL
PSSRCDGIADCLDKSDEEGCAHITSISCKTDQFRQYLCDGDEDCSDGSDERNCTCPSDSF
MCANGKCIMNRWKCDGWNDCIDGSDENFETCENHKCHTNAPPPMRNCSESEFRCSNGKCI
KSAHRCDGEYHCEDHTDEFNCNITCNANEM
Download sequence
Identical sequences T1GJ42
MESCA003483-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]