SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA003861-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MESCA003861-PA
Domain Number - Region: 123-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0187
Family Laminin-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA003861-PA
Sequence length 586
Comment pep:novel scaffold:Msca1:scaffold21264:834:7775:1 gene:MESCA003861 transcript:MESCA003861-RA description:""
Sequence
MCHPWTGECICKPGWTSQQCNRPCPLLKYGKKCEHTCDCKSGSKCSPVDGKCICWPGLYG
EKCELTCPEGKYGQDCKENCDCQNGATCQGETGRCLCKPGWKNYKCDRPCDKNTYGHECG
KTCECHNGAACNPENGECLCAAGWTGKLCDKKCEPGFYGHGCELKCECNMTNTKACEATN
GTCHCINDWGGYIGPNCEHACPVLYFGQDCRQRCQCANGGECNHITGECKCQPGWTGSNC
SLACPDNSYGPNCVHKCLCKHSKGCRKNDGLCICLKGWTGSTCEDICPEGFFGDHCLDSC
NCPNQNFICHPADGCVCRRGFRGDNCDQNASEQFVDDHERLYSETSSAGLTWGIVLALML
VGVIIAVAFYYRRKVSNLKTEMQHVQYITDPHHPDRHNFDNPVYGYPGSDSAHLINGVRP
KLNNLDRSNGNGLIRDWDDNSNASSRGERFFFQMFKNWTYSVQYNSDILQKNMNADMTNP
NTYHTIEPADHVYAEINQKEGYKADPDEYDHLDYSRPSHSKPQYHKMNDTVLNINSDEEK
PSNHKNIDVLPKIPENGDAKLTNGQKQFKETDSDDDEEEVEGAKMQ
Download sequence
Identical sequences T1GK46
MESCA003861-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]