SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA003979-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA003979-PA
Domain Number 1 Region: 239-440
Classification Level Classification E-value
Superfamily GFP-like 5.02e-41
Family Domain G2 of nidogen-1 0.00023
Further Details:      
 
Domain Number 2 Region: 932-1145
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-36
Family YWTD domain 0.0000101
Further Details:      
 
Domain Number 3 Region: 833-896,1157-1198
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  MESCA003979-PA
Domain Number - Region: 597-738
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000119
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 455-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00472
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MESCA003979-PA
Sequence length 1219
Comment pep:novel scaffold:Msca1:scaffold23198:11264:15717:1 gene:MESCA003979 transcript:MESCA003979-RA description:""
Sequence
INTNGILSFSQEFEEYLNQPFPLEYSSIAPFYSNVDTSTANESTRILFFKTQNPSILHKE
SSLIRNSFTEFDSFQAEIVYVASWENVGYFNSRTDKLNTFQAVIICTQTDTFVKFVYPEN
GIQWLRGEVGELGLPDIRAQAGFSSEDGRSFALEGSGTEKIRFLTSSSNINTPGVWLYRV
GFLDYSSDIEQPNHPALKVSIQNPTTAAMDCGKNAIQMPPVLILEMDSVASAMKDSMLSN
NIKAQSYVNLEDGRSYTAINPVNDNAESLLRLALPISGAVGWIFAKPSEVSGTYGNGYQL
TGGKLNHFAYVRFPATGEMVTINQTFEGLNSWDQLIVKIEVNGNIPNVESDKRVNLEDYV
ETYTFRGDNNIFAQSSGKFEFPEDQSSIDFHIEQSIKFEKCAYSEDHLSLQPTFVRISKV
AMEYFSREQAVRTQYTAKISDSSAGELHPCEDGTANCGENTICQKREEDDYDCLCKNGFE
PERSNSTVQNCIDIDECLTGNVCSPDAVCKNFEDNGNELPLPTIEIPLYPTPVYRPEEEP
YNNNPYNESPYDPYPPPEINIPEDFCAHCSRDASCVNGRCECNVGFAGNGETCTIVCLSN
EIYYNNECVPLQTRAECSEDDEEENVCSCPDGYEFDEDDDTCNFIRESNPDCSTEHDCHA
NATCDWSDNFNTNICQCKPGFDGDGYNCYQLEESCLTNPEQCDENAHCLYDPSIQKYECH
CKPGFEGDGSKCIQPNECQADYDCGVNSYCDGGICQCNEGFERDALTSVSKMADVVELCV
AKMLCAELINTIKSNIVNVWLDSLETHSSIVRALLHHVTSEITAACMPPVFHLSGNGQYE
CVCHPGFNGDGYDCVEDITCRNTPSLCDPNAVCLQSGGSFGCACNPGFIGNGTVCREIQS
QEAGFFLIAQGPIITKVPFGMGSKAKPILVSTMSIGLDKDCVEGRIYYGDLLTRRIMSAK
YDGSDARPFITEDIKDVEGIAIDHISRRIYWTDSGKRTIEVASLENPSLRTVIVHKNLIN
PRGLAIDPYFSKIYWSDWSRASPKIEMANLDGTERLTLLESPDVSLPNSLVVIPSSSELC
YADAGNHHISCIDVFSKAMKTIASDVSYPYGLAFTNDNFYWTDWTSKQIDVTDSRGTRGQ
SLRIPFFGSQKMYSIVAVTDDCPIQRNICSVNNGGCSDNKICLINTLAPSGMTCKCTQSS
ENCKMSSTSSEVLHNNYLY
Download sequence
Identical sequences T1GKF6
MESCA003979-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]