SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA004141-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA004141-PA
Domain Number 1 Region: 3280-3303
Classification Level Classification E-value
Superfamily DPY module 0.0000017
Family DPY module 0.00085
Further Details:      
 
Domain Number 2 Region: 2762-2785
Classification Level Classification E-value
Superfamily DPY module 0.00000471
Family DPY module 0.0013
Further Details:      
 
Domain Number 3 Region: 3173-3196
Classification Level Classification E-value
Superfamily DPY module 0.00000745
Family DPY module 0.0011
Further Details:      
 
Domain Number 4 Region: 1230-1253
Classification Level Classification E-value
Superfamily DPY module 0.0000105
Family DPY module 0.0012
Further Details:      
 
Domain Number 5 Region: 928-951
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.002
Further Details:      
 
Domain Number 6 Region: 3582-3605
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.0015
Further Details:      
 
Domain Number 7 Region: 3475-3498
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.0017
Further Details:      
 
Domain Number 8 Region: 2380-2403
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.0012
Further Details:      
 
Domain Number 9 Region: 1934-1957
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.0018
Further Details:      
 
Domain Number 10 Region: 1524-1547
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.0012
Further Details:      
 
Domain Number 11 Region: 823-845
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.0014
Further Details:      
 
Domain Number 12 Region: 1735-1758
Classification Level Classification E-value
Superfamily DPY module 0.000034
Family DPY module 0.0018
Further Details:      
 
Domain Number 13 Region: 3367-3390
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.0016
Further Details:      
 
Domain Number 14 Region: 1020-1042
Classification Level Classification E-value
Superfamily DPY module 0.0000458
Family DPY module 0.0016
Further Details:      
 
Domain Number 15 Region: 2447-2470
Classification Level Classification E-value
Superfamily DPY module 0.000051
Family DPY module 0.0015
Further Details:      
 
Domain Number 16 Region: 1316-1339
Classification Level Classification E-value
Superfamily DPY module 0.0000615
Family DPY module 0.0015
Further Details:      
 
Domain Number 17 Region: 2976-2998
Classification Level Classification E-value
Superfamily DPY module 0.0000628
Family DPY module 0.0023
Further Details:      
 
Domain Number 18 Region: 2554-2577
Classification Level Classification E-value
Superfamily DPY module 0.000085
Family DPY module 0.0018
Further Details:      
 
Weak hits

Sequence:  MESCA004141-PA
Domain Number - Region: 1631-1654
Classification Level Classification E-value
Superfamily DPY module 0.000112
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 2771-2931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000151
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number - Region: 1419-1442
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 2040-2063
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 2272-2295
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 1129-1150
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 3064-3087
Classification Level Classification E-value
Superfamily DPY module 0.000327
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 2665-2688
Classification Level Classification E-value
Superfamily DPY module 0.00183
Family DPY module 0.0027
Further Details:      
 
Domain Number - Region: 1841-1861
Classification Level Classification E-value
Superfamily DPY module 0.0051
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 719-740
Classification Level Classification E-value
Superfamily DPY module 0.0051
Family DPY module 0.003
Further Details:      
 
Domain Number - Region: 2172-2191
Classification Level Classification E-value
Superfamily DPY module 0.00523
Family DPY module 0.0027
Further Details:      
 
Domain Number - Region: 289-310
Classification Level Classification E-value
Superfamily DPY module 0.00575
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 2622-2656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0113
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 3134-3168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0146
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1277-1309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0197
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 472-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0289
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 3648-3681
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 2723-2757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 227-248
Classification Level Classification E-value
Superfamily DPY module 0.0536
Family DPY module 0.0034
Further Details:      
 
Domain Number - Region: 1191-1225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0628
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 1590-1625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0711
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 1697-1730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0753
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MESCA004141-PA
Sequence length 3684
Comment pep:novel scaffold:Msca1:scaffold45032:3:20341:1 gene:MESCA004141 transcript:MESCA004141-RA description:""
Sequence
TFDNTDYSVSEVSLDNTSITPLKPCKSNYYCSSNEVCLAGICSELCNIKNPCKNPFPICK
MLNHKIMCLCADAVYVNNSSCQTIADKGTTTITMSVITTTTPNFTITDQISTNSVTTIAP
KGSTRPNINNDSHTKKYRAYNPINNTNELNLSNINYKTTKNVISTESSTKRVWNTSLLDS
IAVTTPIPTKKSSTRIDTSFEQWHNITAINTEVYATSTSVPIAKDKNCITDEDCNKDQAC
YKNTCRDPCTFAKKCASTALCKTKMHRPICYCPEGHEGNPIYNCTKSLPKCTVNEDCELT
EACVNHKCEIPCEIQSTCGYNAVCVNANHGTDCKCLEGYQGNPYVGCQLVLDYKSVCQYN
EDCPPYQLCDRLNRRCMNACSEDSCGENANCIAENHGYKCECPVGYGGNPNIECELIQGC
KSNSECNSYEACINGKCGSPCKCGSNALCDVTSHKAKCKCPTGYSGNPLISCLPPSNPCE
PNPCGTGAICELDKGNPICYCPKGLTGNPFKACIPDGNECAPDHCGENSGCRVVNGNPIC
FCLPQYEGSPPSVPCKLPSNPCNPSPCGPNTQCTIIRKGFSKCTCLPGYIESPNTIRGCI
EPVNECEPNPCGLGAIFGNPFRQCIEPPKEISLCNPGPCGINANCYIEQSARETCYCIDG
YYGDPYTGCKESTKAVGCDQSACGINAHCIINEYGDSVCVCENGMVGDPYDKRGCHGFEC
QTSDDCPNDKTCMGYKCHDPCPGHCGVNADCKVDAHHPVCYCKSSLVGNPNVRCYSLAIE
PAPKQNPCNNACGLNTECNVLNNRAVCSCIKNYLGDPQTGCHPECVINSDCSDHQSCINK
KCVDPCTGTICGINSICKVLHNTPYCQCSEGFTGDALSQCFPVSRNITKDPCTPSPCGPQ
DICTSYNSDVALCNPCFGSDALYNPHCRPECLSNSECPFDKACLSNRCIDPVKEHVVLEQ
GLHGNPYEQCVVPSIIDQPENVNCNNIQCGANAHCKTVNKISKCVCKSGYHGNPQLSCYP
ECTINPDCPFDQACVNSKCINPCLSSSTCGRNAKCSVINHTPLCSCEPGYEGNAYIECKH
IYLPPGKDVSPCEPSPCGPNSRCLVSPEGHAACSCLPNFKGAPPFCQYECVINSDCPQDK
SCLDYKCKDPCVGVCGVKAVCRVYNHNPICSCDSGYEGDPFTACYPPPENKQINPCTPSP
CGPNSICQVKFDRPVCSCIKNYIGVVPHCRPECSVNSDCPQNKACINDKCQNPCTNACGL
NAKCVVVNHGVNSSDMIDPCHNNPCAQNALCKVQNNAAKCVCISPYIGDPYSSGCKPECV
YNSDCPSTLSCIRQHCRNPCTGLCGAFAECKVTNNVPSCNCINGYEGDPFAGCTQTKITP
QSSPCDERPCGPNSICRNINGRPACSCQTGFLGTPPYCRPECTVNSECKQHLSCINRICQ
DPCQGSVCGINALCKVHYHNPICSCKENYVGDPFERCIPGPAKSANPCNPNPCGPNSECK
ETDNHSHPVCSCSPGMFGIPPNCRPECIINQDCPSNRVCIRNKCEDPCAGGSCGINARCE
VINHNPVCNCMERFEGIHMQVVIRKEVIIDITHSPCSNNPCGVNAICKEQNGIGACVCLP
EYYGNPYINCKPECIVNSECDRTKSCVNMKCINPCLNSCGLNSECNVINHRPVCSCPEGY
SGNPLELCVIETKVLVPSNPCSPSPCGINSICRIKDNRAVCRCLPNFLGSPPNCRPECVI
NSDCGMTSICLNSKCIDPCTEGVCGLHAECRVVNRAPICTCINGYSGDPFNVCHPEKLVN
IEPIDACNPSPCGPNSICKRNGLDAVCACVTNFIGRPPNCRPQCTINSQCPMHLSCVNNK
VTSHIPRCYCEQGYTGDPFSNCIPIVEPIISKAEPVSPCQLSLCGINAVCSERNEAFSCK
CIQNYIGDPHIECRPECIINNECPITKSCINNKCVNPCIDMSCGSFSKCFVLNHMPMCVC
EEGYSGNPYSSCNPIIIKEEIQVNPCNPSPCGPNSNCRAVDNIAVCSCVATYIGSPPNCR
PECVLNSDCSQNKLCKNHICIDPCTQATCGLDSECKTIGHRPICSCRQGYTGDPFINCVP
VTPQKDIYENSCIPSPCGPNSQCTVIREQPCKDPCLGTCGPNALCTVKYHKPICTCKEFY
YGDPYSICSLIIVSSDCPQNKNCNNQKCVDPCVGACGSNANCLVINHYPSCSCSSGYEGD
PFKACNKIKLVIEPENPCLSSPCGPHSKCVLNGETAACSCLPNYIGRPPHCRPECMSSSD
CDGTLACSNHKCINPCLGACGVNTICNVMKHNPICQCENGYTGDPFSGCTVIIENEPTEA
PVSPCEPSPCGVNALCKEQNGIGSCACVDDYVGNPYTGCRPECVQNSDCDNSRACLNNKC
RDPCQGSCGVNSDCRVYLHAPLCQCMPGYTGNPMTSYNFIGSPPNCKPECIVSSECPQNQ
GCIDQRCKNPCQTDTCGLNARCHVINHNPICTCATGFSGDPFVSCTEVAITTEKSIINAC
EPSPCGPYSKCLVKNNQPVCTCKENFVGRPPFCRPECSSNDDCENNLACINDKCIDPCLD
SCGLNADCKVIRHNAICVCRDGYEGDPFSQCHAIEIVSEKNVPITPCTPNPCGPNAECRE
QNEAGACFCRNGFEGNPYDLDRGCRHECEVNSDCALNNACVKFKCINPCVGICGTYAICT
IDNHIPDCTCPPGMTGDPLFQCTEIDPCSPSPCGPNSICKEINKKPVCSCHPDFSGSPPN
CRPECIVSSECPSTRACINNKCADPCPHTCGSRAQCNTINHSPICSCPAGLTGDPFSQCS
PIAITVEPEPTAKPPSCVPSPCGPNSQCQIIGQSPACSCQPGYIGTPPHCRPECAINSEC
QSSEACINLKCKDPCTAGVCGIEAKCHVQNHIPICTCLEGYSGDPFSQCVAIPIEKTPIY
KDKCNPSPCGSNAICMNGDCKCQENYFGNPFERCVPECTLSSDCPRDKTCWRNKCVDPCH
GGLCGRNAKCEVVNHIPTCSCFEHFEGDPFNECREIIKLLEPTDPLILHHVDQTVNVEIS
MNMQPECVVNSECSSFESCHNKKCVNPCQENTCGVDAKCEVINHSPICACTAGKTGDPFR
GCYDIIEPPPPKNIQTDPCYPSPCGPNSQCKATGEHYVCQCLQDFIGTPPNCRPECIVNS
DCVSNNACINSKCQDPCKMSGVCGLNSECRVLNHILSCSCPSGYVGNAFVQCLPREEPIS
KPCDPSPCGPNAICEESNTLEKCRCIEDFLGDPYSINGCRPECVINSECPSNQACVNNKC
ADPCGQSICGNNAKCYTTNHVPSCVCSEGYEGDAINGCYSPPSTPTIIKDPCYPSPCGQN
RAPPNCRPECIINSDCSANTACHKYKCRNPCESGACGINSKCDVINHYPICSCPTGMTGD
PFSKCVREDFTPPAPKNEDPCTPSPCGLYSNCLVAGSHPVCSCLQGYVGTAPNCRPECVV
NSDCPIDKTCLSEKCVNPCDGGACGFYAQCRVQNHVAICSCDQGYTGDPFIQCTRLIEPP
KVVQPDNTDPCSTQVCGSNSVCRNGACACKPDYFGDPYVGCRPECVFNTDCSPNKACINK
HCVDPCTPSTCGRDAICEVSNHIPICSCRNGYEGDPFKLCRVVEKIIEQNPCQPTPCGPN
SNCLAKSSTAVCSCQIGMTGSPPY
Download sequence
Identical sequences T1GKW0
MESCA004141-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]