SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA004618-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA004618-PA
Domain Number 1 Region: 26-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000195
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  MESCA004618-PA
Domain Number - Region: 2-28
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family Laminin-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MESCA004618-PA
Sequence length 266
Comment pep:novel scaffold:Msca1:scaffold35519:7810:8997:1 gene:MESCA004618 transcript:MESCA004618-RA description:""
Sequence
PGVTGDKCDRCAANHYQFGPHGCQPCNCEVKGSLDNVPSCDPESGICLCKDNVEGRRCRE
CRPGFFNLDLDNRFGCTPCFCYGHTSECQSALGFSQVSMNSNFNRNQERWQALDYEDEIY
RXFSQVSMNSNFNRNQERWQALDLNGIPADLKYNQFSQSIATVANGKDNIYFIAPDRFLG
DQRASYNKLLKFKLQLVGQTAPNPNAQDVILESGSKKIALPIFAQRNSIPDHNVKEYVFR
LHEHHDYNWQPSQSAKSFMSILANLT
Download sequence
Identical sequences T1GM50
MESCA004618-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]