SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA004917-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA004917-PA
Domain Number 1 Region: 160-295
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-23
Family YWTD domain 0.00015
Further Details:      
 
Domain Number 2 Region: 109-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000979
Family EGF-type module 0.042
Further Details:      
 
Domain Number 3 Region: 38-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000108
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 2-29
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MESCA004917-PA
Sequence length 296
Comment pep:novel scaffold:Msca1:scaffold46368:4091:8062:-1 gene:MESCA004917 transcript:MESCA004917-RA description:""
Sequence
MFTCGNGRCINNLWVCDHDNDCGDGTDEGKFCNSKYKTCSPEDFTCQNFKCIRKRYRCDG
EDDCGDHSDEVDCKKENVTCPAGKFQLSDCSDDSDEPAHCNVDECAKVEIHQCGHKCVDT
LTGYYCDCNQGYKLLADGKACADIDECLEKPGVCSQHCSNTPGGYYSISVDWVADNLYWA
EVDRTGSKPRGRIMVAKTDGRYRRAIVSAGLEIPTSVVVNPQLGRMYWSDAGSAPKIEVS
WMDGSKRRPVITEAIRHPAGLTIDYAQDHTIYWVDTKLNTIESMKPDGSIRKTIVK
Download sequence
Identical sequences T1GMY1
MESCA004917-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]