SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA005268-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA005268-PA
Domain Number 1 Region: 204-444
Classification Level Classification E-value
Superfamily vWA-like 1.72e-78
Family Integrin A (or I) domain 0.000000424
Further Details:      
 
Domain Number 2 Region: 449-531
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-20
Family Integrin domains 0.00091
Further Details:      
 
Domain Number 3 Region: 699-784
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000000183
Family Integrin beta tail domain 0.0012
Further Details:      
 
Domain Number 4 Region: 36-87
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000246
Family Plexin repeat 0.004
Further Details:      
 
Domain Number 5 Region: 609-649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family Integrin beta EGF-like domains 0.0099
Further Details:      
 
Weak hits

Sequence:  MESCA005268-PA
Domain Number - Region: 655-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family Integrin beta EGF-like domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA005268-PA
Sequence length 857
Comment pep:novel scaffold:Msca1:scaffold38286:10118:22259:-1 gene:MESCA005268 transcript:MESCA005268-RA description:""
Sequence
MAQRTRQIFSIRNMFLVILIVSFASAQLSEKLQAGDPCTSKTNCRSCIQTPKCAWCMQLE
FGETKPRCFQPEHAIPLYCPEGFTINPDTEQTYIGNEMLTVERHRLQSSGGTMVSGGSYS
ANSSYGSSFSSSSSAESGGFSSAKGSSSSSRSGYGSSSMSGGSSSSSGGSYSSQGGIVQI
SPQRINLQLRVNEPHRIDFNYAQAQDYPVDLYYLMDLSKSMEDDKEKLSTLGDLLATEMK
KITSNFNLGFGSFVDKVLMPYVSTVPKKLEQPCDGCAAPYGYRNHMRLNQNTTEFSSEVK
SAKVSGNLDAPEGGFDAIMQAIVCKDQIGWRDQARRLLVFSTDAGFHYAGDGKLGGVIEP
NDGHCHLENGIYTHSSIQDYPSISQINHKVIEQSINVIFAVTASQIDVYNKLSQHIEGSS
SAVLSEDSSNVVELIKGEYDKITSVIEMKDTASGEVKITYYSACLGNGPAIQTNKCGGLK
QGQTVKFEAEIVVTKCPEDPKDWQQTLQIYPVGVNESLTIDLTMLCGCPCETGGPMTGDL
KCGICECDNQFFGRKCECSSQDTTALNELANCRADNSSLECSGKGNCVCGVCECETRSPT
EVFSGKYCECDNFSCDRFAAQICAGPDHGTCVCGKCECKHGWTGSACECPASNDECMPPG
GGEVCSGHGTCECGKCVCKTTDDGRFSGKYCEKCPTCSGRCAELKECVQCQMYHNGNLYE
NGCDTNCTHFTPKSVEKVEIDESKGEYKCVFYDEEDCKFTFKYYEDLATKQILVEAEEKR
ECPPKVFMLGIILMVIGAIVLIGLALLVLWKVLTTIHDRREFARFEKERENARWDTGENP
IYKQATSTFKNPTYAGK
Download sequence
Identical sequences T1GNV7
MESCA005268-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]