SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA005817-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA005817-PA
Domain Number 1 Region: 188-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000109
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 2 Region: 226-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000639
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 3 Region: 29-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000383
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 4 Region: 410-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000051
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 5 Region: 149-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000931
Family EGF-type module 0.003
Further Details:      
 
Domain Number 6 Region: 314-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000439
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 108-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000622
Family EGF-type module 0.017
Further Details:      
 
Domain Number 8 Region: 69-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000119
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 9 Region: 450-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000919
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  MESCA005817-PA
Domain Number - Region: 354-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00176
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MESCA005817-PA
Sequence length 525
Comment pep:novel scaffold:Msca1:scaffold11173:3306:7849:-1 gene:MESCA005817 transcript:MESCA005817-RA description:""
Sequence
MNAESVVFGACPLALGPCSDHDVLIKMQPDHCLHEPCMRQGICTSNSEGYECHCTQRYSG
KNCEVDLGSPCLSAPCLNGGSCNEDDKGNYVCRCPQTHSGLKCENEISNHPLCMDQPCKN
NGTCKVLSNGKTVECDCLKGFSGQYCQVNNDDCASSPCYNNGRCVDMVNGFACDCSGTGY
SGTLCQININECSEKPCQNGGICYDTYGSYICECLNGFGGDNCEKQTNECQYQPCQNGAS
CIDKQGSFKCVCTPGFSGIFCENAPLCPHCPIDSECINGKCVCKPGSSGPIGHCVPTPEP
KPIKSSPQSRSAQLNACSHSICLNGGTCNGNASNYTCNCANGFSGPHCENTVNDCQCLNG
GVCSGNGTNCSCPNGFDGSKCEKSEQCSPANCPNPMICSKNKCICTENTNCDACKSNPCL
NGAVCKPSGLSYECICPNGWNGTNCQQETNECSAFNPCKRGICTSKKGEPYKCYCEPGFT
GLHCDIDVDECLANLVKMEQLVLIRLTIISATVLLAIPERIAVWI
Download sequence
Identical sequences T1GQB3
MESCA005817-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]