SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA006476-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA006476-PA
Domain Number 1 Region: 156-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 373-503
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000345
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 547-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000443
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 327-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000711
Family EGF-type module 0.006
Further Details:      
 
Domain Number 5 Region: 638-675
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000147
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 743-784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000739
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  MESCA006476-PA
Domain Number - Region: 1096-1152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000243
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 949-981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00634
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 605-652
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0234
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 710-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0629
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 301-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0986
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MESCA006476-PA
Sequence length 1157
Comment pep:novel scaffold:Msca1:scaffold49845:5:15936:1 gene:MESCA006476 transcript:MESCA006476-RA description:""
Sequence
MCRTVCNSDEYCSGQQICENRLCQIGCRNDNMCPSNQSCVNKKCKNPCEIIGQCGSCSEC
SVVNHSVQCSCPAGFIGDGTSSCIKSPEICNDQCQCDEHGQFCAGKCSRSSDCSCGEICH
TGKCRLKCSKNKPCPIGQRCERGGACVGGCNKNTDCNFNNVCEAGQCVNPCEKDNACGKN
ALCTTTNHQLFCYCPDGFKGEPNEEYINECRDSPCGENAVCTDTVGSFTCSCLPEYKGDP
FKGCVDINECEELDHPCGKSAICENEEPGFKCKCPQGFQGKPDPKTACEQVDVNIACQSN
FDCTNNAECIDNQCFCLDGFEPIGANCIDVDECRTHEDLCGAHSMCVNTPGSFMCTCENG
YVGEPPRTLCKEPCADVNCGKHAFCKADAAEAYCICDEGWSFNPNNISAGCVDINECESS
VDKCGMNAICENIPGSFSCKCPIGYLGDPYTKCEVEDQCAKENVCGLGAVCENTPNGFNC
ICSDGYIPDPSPFIQCSLVLKCSENKECPGNSICTENKQCLCPNPNIGNDCRHPCESLTC
EGFTGNSGKDCVDVDECKNNPCSQGALCVNLPAKYECQCPSGYVGNAYENGCSKSEGDFV
CSNEKPCPNSEECRFDGFTGQNVCICQQGYERNSDGKCEDINECQSEKHTCGFNGICKNL
PGSYQCYCPNGFYGNPFELCEECTTPECKCQSPYKMVGNSCMLAGCKNKKDCPNGAECIS
ISDNVSYCACSKGFKSTSNGECQDINECLEPNTCSYGAQCINNIGNYTCVCTEGTKGDPY
NGLCAPSQQQCSLDTDCKFNEKCVEPGECICPPPYFVDSKDNKCKSPCERFFCGINARCT
PSDPPQCMCDVGFVGDPLMGCKGGYQCLCPKGMTGDPYKSGCILEAGSTKAQCTRNEECS
SNLACSNGNCVSPCSNLLCGENAFCETENHAAWCRCKVGFIEGANGGCVSQCKDYICGKG
AVCIPTSDGPTCKCQPKYKGNPFPGGECKLDECTSINQCSHPQVCINGRCKERCDDIVCG
ISASCDKFTGKCVCDFNFIGDPNLLCMPPITTPSCNPNCGKNAHCQYKNNNNVCVCNDGA
TGNPYEGCGPQKKTTCEPNSCGENAECRSDLSDISCLCPPGFTGNPYLGCSDINECDSSP
CGSNAICLNNFGSFDCV
Download sequence
Identical sequences T1GS28
MESCA006476-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]