SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA006477-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MESCA006477-PA
Domain Number - Region: 62-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000977
Family Merozoite surface protein 1 (MSP-1) 0.071
Further Details:      
 
Domain Number - Region: 20-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00628
Family EGF-type module 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MESCA006477-PA
Sequence length 148
Comment pep:novel scaffold:Msca1:scaffold49845:15951:16425:1 gene:MESCA006477 transcript:MESCA006477-RA description:""
Sequence
MYNIDCPVSQLCNRLTHSCENVCGKETCGQNAVCLADDHKALCQCPPGYKPNPLPEVECS
LITGCTSGLCHRSAICEMTSNGPICKCPEHFEGNPYGEVIPFAQKTLYVKMDNVKMYAIA
TVVKILNVRLLMENPNVYVFPSLHPMEI
Download sequence
Identical sequences T1GS29
MESCA006477-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]