SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA006759-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA006759-PA
Domain Number 1 Region: 11-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000306
Family EGF-type module 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MESCA006759-PA
Sequence length 139
Comment pep:novel scaffold:Msca1:scaffold55362:3131:4164:-1 gene:MESCA006759 transcript:MESCA006759-RA description:""
Sequence
MEPSVKNVTQCQDFDECSINAICDQKCKNTPGSYECSCVKGYSKSGNRCIAINVPAGENA
TLVFITQNNMQRTSLNGQAYEIQSNNKMSILDVWHRNRTVCGLTTTTPPQFQCQKIDNFD
QKWQINLPPILSSFDCEYI
Download sequence
Identical sequences T1GSU7
MESCA006759-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]