SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA006828-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA006828-PA
Domain Number 1 Region: 624-772
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.83e-24
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0045
Further Details:      
 
Domain Number 2 Region: 390-452
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000403
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 190-322
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000425
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.01
Further Details:      
 
Domain Number 4 Region: 37-106
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000236
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 92-154
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 1333-1376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000028
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 7 Region: 1452-1500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000188
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 8 Region: 1296-1340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000375
Family EGF-type module 0.021
Further Details:      
 
Domain Number 9 Region: 323-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000039
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 1490-1528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000143
Family EGF-type module 0.019
Further Details:      
 
Domain Number 11 Region: 1412-1456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000202
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 12 Region: 531-599
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000417
Family Complement control module/SCR domain 0.0058
Further Details:      
 
Domain Number 13 Region: 149-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.022
Further Details:      
 
Domain Number 14 Region: 1371-1415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000147
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 1145-1282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000157
Family Growth factor receptor domain 0.0066
Further Details:      
 
Weak hits

Sequence:  MESCA006828-PA
Domain Number - Region: 1-39
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000139
Family Complement control module/SCR domain 0.0056
Further Details:      
 
Domain Number - Region: 947-1002
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0138
Family Complement control module/SCR domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MESCA006828-PA
Sequence length 1530
Comment pep:novel scaffold:Msca1:scaffold48146:1631:8499:1 gene:MESCA006828 transcript:MESCA006828-RA description:""
Sequence
MYQCYAGFTFLTNLPVEKITCLPDGNWEKKPACVASQCSNLPEVPHANVTILNGGGRSYG
TILKYECENGYERSGLPVLICSGTWSGEVPKCTRKKCKKLPNIKNGFIVDKTKEYAFGDE
ARVQCYKGYKLQGSNIIRCDSDQQFSHLPTCVDINECATTQCDLATTECMNTDGSFFCQC
KKGFSKTSECHRIGDLGLSNGGLPDDSIITSSSEEEYTSEMVRLNSAGWCGNSLESGSNW
VIIDFKAPIILKGFRTMSVQRFDENIAFSTAVRLQYTNNITDVFKDYTNPDGTAVEFRIL
EPTLSILNLPLPIEARLEAMGCNRLDCVDINECVNNNGWCDQKCINSPGSYSCACNNGFQ
LFTSNGTSGYDIAKFENGKREGDIYFINKTCVPVMCPALSSPENGLLLSSKSKYNYGDVV
SFQCNFGYIMSGSSALSCLGNGNWNASIPECNYAKCISLPNDKNEGLSVIRTNMDIPLVS
FKENVTLTCNSLGRHLRGTVTAGIRQCVFDPKLGYPSYWLSGKNPSCPRVDCGVPAPTPG
AEYGQFVDTKYQSSFFFGCQNTYKLAGQTSKHDNVVRCQGNGIWDFGDLRCEGPVCEDPG
RPSDGTQIARSYEQGSEIYFTEPECKIIKPLGITSGKIPDSAINATSERPNYESKNIRLN
SVTGWCGKQEAFTYVSVDMGQVYRVKAILVKGVVTNDIVGRPTEIRFFYKQSENENYVVY
FPNFNLTMRDPGNYGELAMITLPKFIQARYVILGIVSYMDNACLKFELMGCEEPKNESLL
GYDYGYSPCVDNEPPVFHNCPQQAIVVQRKENGELLPVNFTEPTATDNSGSIARLEVKPQ
NFNVPSFVFKNSVVKYIAYDYDGNVAICEINITVPDITPPLLNCPQSYVIELVDKLQNYE
VIFNETRNRIKTFDLSGEVHLTFIPERANIPIGGNSQPTPCVDWELQAPENGEINCRNED
KGLKCMATCKAGFRFTDGDVNKIYSCHSSRIWKPSTIIPDCVSENTQQADYLVTASVLYR
ANGVVAQNCLGQYQELLSQYYGNLNTILSNRCSAVAINMNVSFVKSVPTLIEENVLQIDF
IMSILPAVKQPKLYDICGSTLNLIFDLSVPDTSAVIEPLLVVSSIANQCPPLRALKSSFT
RGFSCSTGEVLNMDTTDVPRCLHCPAGTFAISGQSICTPCPKGYYQNRDRQGSCLACPQG
TYTKEQGSKSLSSCISVCGYGSYSPSGMVPCLESSKPDLCRAKCAPGTYSATGLEPCYKC
PQNFYQNLEGSQTCNECPGNMKTENLGASGREDCKIVSCNENSCHHGGLCVAIGHAPKCF
CPAGFSGERCEIDIDECASQPCYNGGKCIDMPQNYRCECPPGYSGINCQEEISDCKNDTC
PTRAMCKNEPGFGNYTCLCRSGYTGNKCDVTIDPCSSSTNPCQNGASCSALQQGRFKCNC
LPGWEGINCEINIDDCEENPCLLGANCTDLVNDFTCSCPHGFTGKRCEEKVDLCLSEPCK
HGICVDKYFGHECICHEGWAGKSCDINSDD
Download sequence
Identical sequences T1GT10
MESCA006828-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]