SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA006829-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA006829-PA
Domain Number 1 Region: 221-371
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000884
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  MESCA006829-PA
Domain Number - Region: 422-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 154-203
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0251
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA006829-PA
Sequence length 589
Comment pep:novel scaffold:Msca1:scaffold48146:2:2583:-1 gene:MESCA006829 transcript:MESCA006829-RA description:""
Sequence
MYLASIGSDIVLKPFKIIGALKSIITQFEPDSNELPHQPAELSLTISEVYSSSLEDLLPP
PLRIVTFACGTSGRFEHWEATHAGFFSQLPSGKHELGGGGANSDPVIQQQTGERSTIKKL
LEQLILVDDKFSVDDVLPNTNLEPSSIILKSEYTCPVGQVVMEPDCVPCAIGTFYESNNK
TCVSCEKGTYQSESGQLQCSRCPVIAGRIGVTAGRGSRSASDCKERCPAGKFFDAQSGLC
KACGYGFYQPNEGSFSCLLCGLGQTTRSTEATSKNECRDECESGMQLGIDGKCEMCPKGT
YRMKGMHSSCVNCPLGRTTLKMGSMTVEDCSLPICNPGTFLNTTTNICINCRKGYYQPDF
QATSCIACPPNHSTKDSGSTKKTDCSNPCEDNVSQKEKCDTNAYCILVPETSDFKCECKP
DVCEGFCENSGTCFKDLKGTPSCRCVGSFTGPNCLEKSEFAYIAGGIAAAVVFIIIIVLL
IWMICVRSNKRRDPKKILTPAIDQTGSQVNFYYGAHTPYAESIAPSHHSTYAHYYDDEED
GWEMPNFYNETYMKDGLHSGKMSTLARSNASLYGTKEDLYDRLKRHAYP
Download sequence
Identical sequences T1GT11
MESCA006829-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]