SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA006911-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA006911-PA
Domain Number 1 Region: 29-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 2 Region: 76-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000385
Family Laminin-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA006911-PA
Sequence length 204
Comment pep:novel scaffold:Msca1:scaffold51629:89:5038:-1 gene:MESCA006911 transcript:MESCA006911-RA description:""
Sequence
MCEKCAEGFYGDVNKNGCKPCPCPEKSKNFAQGCTVDGNGAVQCICKNGYKGYLCDECSE
GFFGNPLSNNGTCEPCQCNEKGIYNHGCDSRTGQCFCKEGILGLRCNICNNERHYLDGSS
CKICDNCTLSLLDHTDKISHILEVSFKNVDLSGIPAPWLMLDSFDIRANALYEKYTTFND
AKDGIESFNTITLQKMELLSEQEH
Download sequence
Identical sequences T1GT87
MESCA006911-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]