SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA007874-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA007874-PA
Domain Number 1 Region: 78-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000122
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 34-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MESCA007874-PA
Sequence length 217
Comment pep:novel scaffold:Msca1:C779696:9340:11904:1 gene:MESCA007874 transcript:MESCA007874-RA description:""
Sequence
MKRRLQGKHLPLPPTMNGTQWGQATMGKNILKGCISNNMCLNVVCPDPFECNNIWMGYEC
SCGDGRIKSPDGRRCLDRNECLEDKPCMNGGTCINLEPRRRYRCICPDGFWGENCEILQE
EQTNSKIYYSSLAAILVITVLLIVSDGSVNWIPDENDFCGYIYIYRVWMFSDAILMNFNS
DASLWEISFLRNRTVGNAGNGNNEKSIELERLQLQNA
Download sequence
Identical sequences T1GVQ8
MESCA007874-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]