SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA008236-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA008236-PA
Domain Number 1 Region: 233-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000108
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 355-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000191
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 3 Region: 228-357
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000534
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 419-531
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000068
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA008236-PA
Sequence length 650
Comment pep:novel scaffold:Msca1:scaffold5427:8599:27220:-1 gene:MESCA008236 transcript:MESCA008236-RA description:""
Sequence
MSRVQKLSSLHDRSLCGWCSLTSLCLPRTANESIFCVNDQNWNYLTIQAEQCSNCSDYIN
CKDCLESSECEWWVDDAKCERVGRAALAVKSIDKCPVPCKERQGCSECLDQGGRCVWCES
SQKCFSFSAYTSEFQFGMCREWYDQVVPRINSGPGQNTTHLASEKKPQCKSCSYFNDCAS
CLKALNCGWCYDSENPIKGKCVAGDFSNPVQTCNSVLNTTHLTAEWAYAQCPDVDECNLN
IHHCHKEAKCTNTHGSYTCQCRKGYVGDGRISCIRTCYETCIKGKCSNSPNYECICDLGW
TGKDCSIDCGCNNHSHCEKVGVCESCQDWTEGEHCERCRPGSYGNATTSEGCSPCECNGH
GNQNLGVCDSRTGHCFCQDNTDGLKCEKCQKNYYGDPKNGGTCYYQCESRGYFTGLEKKS
FGSFHSFKNPWSDHEVHECLWAVSPANVSGSVLITLEIDWSSMNVNCEENAAYVYDGQPD
LLGQYPQSQLVGVICEPYTVQRPIETRSGHMTVYFKQTGKTKDGFNAHYSIKSCEKSFKE
KCICPGTKIGPKCKESVCPEECNYKQQHGYCDMDYGRCICYNGWGGNGCETRIQSHQLIS
QTLFNTANLYDQLEHLRITIPRFGHSLSADKRGSLWMFGGYSLPNGPLKI
Download sequence
Identical sequences T1GWQ7
MESCA008236-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]