SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA008441-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA008441-PA
Domain Number 1 Region: 2-115
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-19
Family YWTD domain 0.00015
Further Details:      
 
Domain Number 2 Region: 423-534
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000889
Family YWTD domain 0.001
Further Details:      
 
Domain Number 3 Region: 118-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 154-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000511
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 5 Region: 193-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 234-275
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  MESCA008441-PA
Domain Number - Region: 377-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000363
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 290-340
Classification Level Classification E-value
Superfamily YWTD domain 0.0034
Family YWTD domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA008441-PA
Sequence length 536
Comment pep:novel scaffold:Msca1:C755286:2:4868:1 gene:MESCA008441 transcript:MESCA008441-RA description:""
Sequence
MGMDGSNFTRILTWNDDIAWPNTLTIDYFTDRLYWADAHLDYIASADLEGRHRHIVLSGS
KVPHVFALALFDDNIYWTDWNLNAILTANKFTGANYTVLRNTTHRPYDIHINHPGGGPTC
GPNEFQCDSGRCIPASARCDQENNCGDNSDEFDCANVTCGAAQFTCANGHCIPQMWKCDS
ENDCQDGSDEGDFCAARTCAYFQFTCPRTGHCIPQSWVCDGDDDCFDKQDEKDCPPITCL
ANQFKCADLRQCVEEAYKCDGIPDCNDASDELGCPSMGPNQCNQEKHFRYTIQKISYSGG
NRQIIRRNLPNPMGIAIHLGEVYWVDRNLMSVFKASKLPGSTTMPEKVRTNLQKLRDIAI
FDISNQPADENNPCARLGNGGCDQLCFSFPTEASSQRSSNFKCECATGKLSQDGKKCETV
NEYLVFATRTEIRAVNLDPRSTQVPFSPMVNLTNVVGLDFDYADDKLLFTQIRPWAKIAY
TKASSPAVTDVNVVLNRGINPEGIAYDWTQNKIYWTDSSNNSIYAMNLDGSDLVMI
Download sequence
Identical sequences T1GX99
MESCA008441-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]