SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA009354-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MESCA009354-PA
Domain Number - Region: 10-45
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000102
Family Spermadhesin, CUB domain 0.0085
Further Details:      
 
Domain Number - Region: 52-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00156
Family Integrin beta EGF-like domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA009354-PA
Sequence length 87
Comment pep:novel scaffold:Msca1:C740474:2:642:-1 gene:MESCA009354 transcript:MESCA009354-RA description:""
Sequence
MYKKDFSIRKVPEIVAESGSALLHFFSDDAYNMSGFNISYKVNGCPTNDSRVECSGFGAC
MDDGTCSCENLYTGEACNIALCPNNCS
Download sequence
Identical sequences T1GZQ0
MESCA009354-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]