SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA010024-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA010024-PA
Domain Number 1 Region: 147-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000004
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  MESCA010024-PA
Domain Number - Region: 88-146
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.034
Family HBL-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA010024-PA
Sequence length 194
Comment pep:novel scaffold:Msca1:scaffold47351:3:1147:-1 gene:MESCA010024 transcript:MESCA010024-RA description:""
Sequence
MDLSSNEMMLLVFERMVLRIIFGAICVNGKWRIRPRIFSKDGNLHISPAADKNVVIRCDG
KSNFFVNNVNVLDSLRNVTKKYDDRYESQLELTKDIENIRNVLHTLNNQMNIISNRTQTS
NFQDIPRIQRRLRNAQSSIRALKANIDLDECSSDPCKNGGTCVDLYKRFHCLCPEGWAGA
SCEMDIDECYGLAG
Download sequence
Identical sequences T1H1G3
MESCA010024-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]