SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA011188-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA011188-PA
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-18
Family YWTD domain 0.00033
Further Details:      
 
Domain Number 2 Region: 149-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000456
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MESCA011188-PA
Sequence length 283
Comment pep:novel scaffold:Msca1:scaffold21159:4:4566:1 gene:MESCA011188 transcript:MESCA011188-RA description:""
Sequence
YISLVKGLHNAIAVDYHYKKGQLFWSDVSTDVIKKSLMNGTRVKDVVKWGLEQPGGIAVD
WIHDLLFWTDSGTRRIEVSTLNGDLRTVIVSNDLDKPRAIVVHPDWFNKSVYRATNVSNI
YKQITQIRDSLSGALDIRTASRSRQPPMWNQCAVGNGGCSHLCLYTGSSYICACPDVPDD
RECSIRPTFIVPPKHDPREEIDQSTQPTEGNYDADTEESNTQTRNIIIISCKKKRHSNGS
SQSVLTFSNPNYHLEAGAKDQKPTIWKRLKYDPNQVGITIFAI
Download sequence
Identical sequences T1H4H9
MESCA011188-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]