SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA012302-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA012302-PA
Domain Number 1 Region: 213-326
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.13e-28
Family Astacin 0.0024
Further Details:      
 
Domain Number 2 Region: 587-681
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-26
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 3 Region: 681-760
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-18
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 4 Region: 535-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000236
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 5 Region: 493-537
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000589
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA012302-PA
Sequence length 761
Comment pep:novel scaffold:Msca1:WGAG00088:5:3336:-1 gene:MESCA012302 transcript:MESCA012302-RA description:""
Sequence
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHRKIQSDTKDIEDDTRYYFVXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCCSFVGKRGNGPQAISIGKNCDKFGI
VVHELGHVVGFWHEHTRPSGKYEVDSLGQPYDYNSIMHYARNTFSKSSYLDTILPVDRPN
SKRPEIGQRVQLSEGDIAQAKLLYKCPSCGRTFQENSXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXPNDQLKFINTFCGSDIPPVITSDANILHIEFRSDKSIQKTGFAAIFQTDV
DECLDNNGGCQHECKNTIGSYICLCNNGYTLHENRHDCKEGACKYEITAPYGNIYSPNYP
GLYPAHLDCVWHFTVIPGHRIKLIFNFFEVESHQNSSLLGVFCSDKLPYPISASTNEMYM
VFQTDKNKQRGGFSATHSTACGGFLRATNHIQQFYSHARYGNANYDENMNCEWRIQAENG
KNIQLDFLFFQLESTINCTYDFVEVEDDISGPSYGRFCGNE
Download sequence
Identical sequences T1H6G9
MESCA012302-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]