SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA000912-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA000912-PA
Domain Number 1 Region: 386-400,472-699
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-53
Family Nuclear receptor ligand-binding domain 0.0000621
Further Details:      
 
Domain Number 2 Region: 317-401
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-26
Family Nuclear receptor 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MESCA000912-PA
Sequence length 701
Comment pep:novel scaffold:Msca1:scaffold18611:17979:20566:1 gene:MESCA000912 transcript:MESCA000912-RA description:""
Sequence
MENEPSSGSSTTTTIYNLSRNNVSVTNIKCEDPPNSHHHQLPHTYFNGGIRISVPPTTTP
TPPPITTQASSSRIPKTEHDSDSETELSNIENSKVNRRTSSNNGTNNANKNGPRPMSWEG
ELSDPEPEEEQMEPATPPTITGGGFSVVKREELAKSDVTISPVLPSSNHNIYHPHVSNQP
INLKYEPTTTSPLLARSKSSTNTSNLLPANPSPDSAIHSIYTHSSPSQSPDASHSSCYSY
SSEFSPTHSPIQGRHIYGGSGGPNPHSVLYRHPLDSNSSSLPSDLSPQNLSQRRDDDSCD
LGIPSTAAGISRQQLINSPCPICGDKISGFHYGIFSCESCKGFFKRTVQNRKNYVCMKGG
PCPVSIATRKKCPACRFEKCLNKGMKLEAIREDRTRGGRSTYQCSYTVPNSMLTSPLMSP
EGSSNSNSTSATPTGYAAGQHTLSSASSCGNLSRLNGLGLKEEPDQQKEKNVPVLLQEIM
DVEHLWHYTESEINYMNQQTSSASSSSTLNSNLAANPLLAGLSSSSGENTNPDLISSLCL
VADHRLYKIVKWCKSLPLFKNISIDDQICLLINSWCELLLFSCCFRSIDFPGEIKMSMGK
SITLAQAKSNGLQACIERMLNLTDHLRRLKVDRFEYVAMKVIVLLQTDRSELREPVKVRE
CQEKALQALQAYTLAHYPDAPSKFGELLLRIPELQRTCQVS
Download sequence
Identical sequences T1GCA2
MESCA000912-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]