SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA004379-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA004379-PA
Domain Number 1 Region: 152-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000052
Family Laminin-type module 0.033
Further Details:      
 
Weak hits

Sequence:  MESCA004379-PA
Domain Number - Region: 54-179
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000122
Family Growth factor receptor domain 0.0033
Further Details:      
 
Domain Number - Region: 195-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0123
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MESCA004379-PA
Sequence length 249
Comment pep:novel scaffold:Msca1:scaffold27934:2721:5671:-1 gene:MESCA004379 transcript:MESCA004379-RA description:""
Sequence
MGLLINNTFAVILPLILVLLPGFVLSELEGQNTCNVVQSYTVNSTVTDVETYQTRVTNWC
LGFPPRCSTYKIKQRKVNKTLTLPKTRIVKQCCEGYIENSDKTRCIPECVDPCKHGVCVA
PNECSCEHGYGGPTCNINCPPNLWGINCEQKCQCENNGTCEPYTGKCECPKGYIGELCEQ
KCSPNFYGLNCMEECRCENGGSCHHVSGQCICAPGFTGPLAMEHELGNEREFQRDTSEDK
DFWILLKAE
Download sequence
Identical sequences T1GLH7
MESCA004379-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]