SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA005860-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA005860-PA
Domain Number 1 Region: 148-454
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.75e-35
Family NodB-like polysaccharide deacetylase 0.017
Further Details:      
 
Domain Number 2 Region: 52-94
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000173
Family Tachycitin 0.018
Further Details:      
 
Domain Number 3 Region: 106-139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MESCA005860-PA
Sequence length 522
Comment pep:novel scaffold:Msca1:C780890:4947:9538:1 gene:MESCA005860 transcript:MESCA005860-RA description:""
Sequence
MAKLLITFAVVAFAAIAVNAQEEPKKEESFEQELCKDKDAGEWFRLVAGEGDNCRDVIQC
TSSGLQAIRCPAGLYFDIEKQTCDWKEAVRNCKTKNKERKVKPLLNTHSLACGDGQCIER
GLFCNGEKDCADGSDENTCDAENDPNRAPPCDLKTCVLPDCFCSEDGTAIPGDLPVKDVP
MMITITFDDAINNNNIELYKEIFNGNRKNPNGCDIKATYFVSHKYTNYSAVQETFRKGHE
IAVHSITHNTDEQFWSNATVDDWAKEMAGMRVIAEKFADIPENNIVGVRAPYLRVGGNNQ
FTMMEEQAFLYDSTITAPLSNPPLWPYTMYFHMPHKCHGNLQNCPTRSHAVWEMVMNELD
RRENPENGEYLPGCAMVDSCSNLMDGDQFYAFLNHNFDRHYLKNRAPLGLYFHAAWLKNN
PDFLEAFLYWIDEILEKHNDVYFVTMTQVIQWMQYPKTLNEIKNFEPWREKCSVEGKPAC
WVPNSCRLTSKEVPGETINLQTCGRCPNNYPWLQDPTGDGFF
Download sequence
Identical sequences T1GQF5
MESCA005860-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]