SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA006351-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA006351-PA
Domain Number 1 Region: 227-472
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.03e-28
Family NodB-like polysaccharide deacetylase 0.036
Further Details:      
 
Domain Number 2 Region: 130-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000094
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 3 Region: 81-117
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000366
Family Tachycitin 0.016
Further Details:      
 
Weak hits

Sequence:  MESCA006351-PA
Domain Number - Region: 23-74
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0863
Family Tachycitin 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA006351-PA
Sequence length 536
Comment pep:novel scaffold:Msca1:scaffold35420:18134:21553:-1 gene:MESCA006351 transcript:MESCA006351-RA description:""
Sequence
MVSASERVKRQDDDVPDINIEELCKDRPGDEYFRLTTEGDCRDVVRCDDAGENGVTRLAS
VRCPTGLAFDITRQTLTGKLKCTKSGLKQITCPSGLAFDIEKQTCDWKAKVPNCDQLEKP
RKALPNLKTIEPICPDGKLSCGDGECINKELFCNDTPDCKDESDENACSVDDDPNRAPEC
DSSQCELPDCFCSADDDHLSFNGAINVDNVDLYEEIFNGVRQNPNGCSIKGTFFVSHKYT
NYSAVQDLHRRGHEIAAFSITHKDDPNYWTKGKYDDWLAEMAGVRLIVERFANITDNTIL
GVRAPYLRVGGNKQFEMMADQYFVYDASITASLGRVPIWPYSLYFRMPHRCNGNAHNCPS
RSTPIWEMVMNELDRRDDPTFDESLPGCHMVDSCSNIQTGEQFGRLLRHNFNRHYNSNRA
PLGLNFHASWLKSKKEFRDELIKFIEEMLTRNDVFFVTNLQVIQWIQKPTEVNSLRDFAD
WKDKCDVKGQPYCSLPNPCPSTTRELPGETLRLFTCMECPNNYPWILDPTGDGFSV
Download sequence
Identical sequences T1GRR1
MESCA006351-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]