SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA008160-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA008160-PA
Domain Number 1 Region: 1-33
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000116
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA008160-PA
Sequence length 155
Comment pep:novel scaffold:Msca1:scaffold54005:4165:4629:-1 gene:MESCA008160 transcript:MESCA008160-RA description:""
Sequence
MNGGICVDGVDSFWCSCPPATTGLLCECHISDYNMECGNFTLVSVDPFSTTSSSLDNVYT
LNSTKIPETETKYDIDADLKTDYFDSIYPVTLPTEDQSVETIVFTGFPYETEATTTEIIS
KHSSEEYYTNSESLEYYDLHTHEETTEIQTTSKPP
Download sequence
Identical sequences T1GWI3
MESCA008160-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]