SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA009739-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA009739-PA
Domain Number 1 Region: 56-277
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.27e-35
Family Nuclear receptor ligand-binding domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA009739-PA
Sequence length 282
Comment pep:novel scaffold:Msca1:scaffold17156:3400:4248:-1 gene:MESCA009739 transcript:MESCA009739-RA description:""
Sequence
MALYKDNVLGDVPNLSHEMLMNASLMPSAVGMSPVVLDLSLQRVPHPSVYSQNSPFINLL
PSRVLPPTPPLIGVEHIKETAAEHLFKSVNWIKNFEKFTKLPMSDQLILIEDSWKDLFIV
AMAQHLYNVNFSQLLYAYETECSNQEYSTIVAKEILRFQEVVNQIVLLRVDLAEFDYLRT
LLLFKSCNNENDSPSIKTTTEKNSLVDSERVRALYEEAKINLINYIQLTYPSQPLRYQTI
MKVVSQTVHISSFTLEELFFRKTIGDITIVRLISDMYIRNVV
Download sequence
Identical sequences T1H0Q4
MESCA009739-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]