SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|568313355|ref|YP_008985630.1| from Rhodococcus pyridinivorans SB3094

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568313355|ref|YP_008985630.1|
Domain Number 1 Region: 7-272
Classification Level Classification E-value
Superfamily Cgl1923-like 4.97e-86
Family Cgl1923-like 0.0000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568313355|ref|YP_008985630.1|
Sequence length 340
Comment proteasome assembly chaperones 2 [Rhodococcus pyridinivorans SB3094]
Sequence
MDEQSRMYELEFPAPQLTSPEGEGPVLVHGLEGFADAGHAVRLATTHLRESLETELVASF
AVDELIDYRSRRPLMTFKADHFSDYAEPELNLYALIDEAGTPFLLLAGAEPDLKWERFIT
AVRLLAEQFGVRRTIGLNAIPMAIPHTRPLAVTAHSTNKDLIAGHHRWSGELQVPAGVSS
LLEYRMGQHGHESVGFSVHVPHYLAQTDYPAAAETLLTNVAEVGGLELSLQALGEAAARV
REQIDEHIEDNAEVLGVVHALERQYDSYVAAQEQQTSPLPTDESLPTGEEIGAEFERFLA
EYDRRGAGPGGDLPGPDDGRTGDGGFGEFDPDDGDDSAPR
Download sequence
Identical sequences A0A1H4Y3A1 V9XBY4
WP_024100699.1.20109 WP_024100699.1.27094 WP_024100699.1.33748 WP_024100699.1.57562 gi|568313355|ref|YP_008985630.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]