SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPR00000014068 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000014068
Domain Number 1 Region: 625-822
Classification Level Classification E-value
Superfamily Sec7 domain 3.4e-64
Family Sec7 domain 0.00000416
Further Details:      
 
Domain Number 2 Region: 155-262,413-584,922-1035,1231-1352,1452-1497,1567-1608
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000000624
Family MIF4G domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000014068
Sequence length 1916
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_71:1461:7383:-1 gene:maker-par_contig_71-snap-gene-0.20 transcript:EPrPRT00000014068 description:"Brefeldin A-inhibited guanine nucleotide-exchange protein."
Sequence
MEAQVLKSLAKLKKLVPRGQRELKDVVDAAITNMTAVVERKTKNQQEGGGGGGLGVSSEV
PFEPFLLAVLTRQAKLVALALDCIEKFLAFGFLRGNGSIPDSIRKRLTQKYGKAGPGGSN
NGSGSRDTLNGASGGAAGSNNDGADEGALNEDNWKLIDCIIEVICDTNDHPDETVQVQVL
RVLLTAVTTPTCEVHEHSLLKAVRASYHIHLVSKNSTNQTAAKATLQQIISIVFQRMETF
DQRVREETEATLREMQKQQQTDTANSRTNTSSDHALDTRTASSTSLSSAESALYPEVARI
LQLPLEAKARPPTARKSARAANGSNHVNTSTIFAPSFPSVLHKDAFLLFRSLCRISMRSV
AEDSPSGSSSYASLTNNASDDPFAFQSKLLSLELVLSIINNAGPSFRGGERFIHAIRQYL
CQSLLQNCTSNYTQIVGLSLQLFLVLINNFKRHLKAEIDIFVTSIFLRILQSEVSSFEHK
MLVLEVLNNICDDGQILGEIFLNYDCDWNTNDLFRQIIDALAKIAKGKKDSAQAYANMSS
AVRIKTQQNDAALVLKGLECLTATVASLKKAANFVETERKAKEAQQQQARDDGDDDQVAP
PPPPPLAAPSSSTTSTMSAVEAFDRKKRRQEELATGILKFNAKPSAGIQYLVQRGHLGQG
TPRDVARFLHDNSAKLNMTEVGEYLGKEQQYQNGFCVKVLHEYVDMMDFAGLEIDVAIRS
FLAGFRLPGESQKIDRMMEKFAERFFSTAQPELFHSADTAFILSFSIIMLQTDLHNPSVA
DEKKMTKEGFIRNNRGINNDESLPDDYMGGIYDRIKKDPISLKEDLDAKARQGGGRSLGA
MASGASIFGASSAVVDRQRRDAYIKERESMVRQSEALFKRRNPSSQSMRGGLTSPTSSSS
ATSPTSSSGSGQFHLVTEFTEMSHVRPMFETVWAPLLACCSVIFESSDAPVAIQLCLHSF
KHAIHLAARLDMPSERDAFVTVLAKFTALHTTGSRIMRAKHLEAIKALISISVKEGNYLG
DAWRDILQCLSQLARLQTHAQGLHNDVDFFNTPGGGGGASGGGGGGGGGGGFNTPSSSST
LSSISTGSRRGGAFGGSGGSGVSPSHRDSGTGSGSMTGMNEDAFNPAIEDENASRVMAEI
DALASDRVFSSSVSLSDTAVQEFVVQLCVVSLSECSGVSSSRSPSQSHASRVFSLQKLVE
VADMNMHTRSRMVWASTWKVLSRHFTTIGCHDNLSIAMYAIDSLRQLSMKFLEKEELKDF
NFQRLFLTPFEVIMANAMSTDIKELVLRCVENMILARETNIRSGWKTIWGVLRVSAETYE
HGDGGKPDTADRIVQLGFTIATRILAQHFDRIIEVFVDAVECLLAFAVCGSDDVERGADE
HVGLTQLSVDSINTLETVCLENLATGQVIEKGLLEAAAAKRVGFKKKKHGTQEAGAPLRQ
EDGTHVYNDSSLHTRVWWPVLTALSTLASDRRMDVRLTALHALFDSLARHGAKFSTGLWS
LIFKGVLIPLLDELRHLEVYVEKSTRPPLKLAVTKERFGSATPPSTSTLCLARLLDMYGL
FYDRVGFLPEVLFLLGKCMDTSDREEDLAAAAAAALEHMLVTHGHKFPEDVWGLIADELR
SVMARAEPTWIFYTLPEPPVIPSTASSLLSPRTPQLLAMYASVPSVLGFKFASTFPPRIV
SDDEIQAQKVPSRTHLIVVLAVQKVLGNVLVSRLPRRLAVSDGHTQSLMNTLRESFSFAR
KVNDAVELRRHLASQGWVYGRLDPRGPPGEDDLPNVLFQEVQGKDEYIKVLFHYITAPGH
DDRKREDARRQMTVLVQQTMEEYLAWSEADASGTRSGGKKTRALSTPGSSSSRDGLGSAI
PVDAVQRVTRYATLMVSVLTQLAQCSGPERLMGFQCFAADPPTARAPLAVAVSAAE
Download sequence
Identical sequences EPrPR00000014068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]