SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407718165|ref|YP_006795570.1| from Leuconostoc carnosum JB16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407718165|ref|YP_006795570.1|
Domain Number 1 Region: 8-78
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0000981
Family Occludin/ELL domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407718165|ref|YP_006795570.1|
Sequence length 79
Comment hypothetical protein C270_03290 [Leuconostoc carnosum JB16]
Sequence
MKILDNIKNLSAQLKEISRLLNQLKAQQKNLVEQVDQIKTTSDEIQVEIEKMNFKNKPHL
DRIKETTEHLNDQLSKFKA
Download sequence
Identical sequences K0DCA3
gi|407718165|ref|YP_006795570.1| WP_014974183.1.85428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]