SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN00644-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  DPGLEAN00644-PA
Domain Number - Region: 18-67
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00392
Family CRAL/TRIO N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN00644-PA
Sequence length 91
Sequence
MFYNLLQIGMPTPDYNVDLDLGEPPPELQEYARLQCGEDPNTKLQAIYELRDMIYGMYKV
ETKFYEYYAFILFCYELIPTFRFLKVSIQQL
Download sequence
Identical sequences DPGLEAN00644-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]