SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN01184-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  DPGLEAN01184-PA
Domain Number - Region: 220-284
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.012
Family BAR domain 0.025
Further Details:      
 
Domain Number - Region: 61-152
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0245
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 128-238
Classification Level Classification E-value
Superfamily Globin-like 0.0555
Family Globins 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN01184-PA
Sequence length 472
Sequence
MADMQAGLGEEPVPPPPSTPPPTTVVSTTEPAPPLAPKSAPSIAGRRKSDFPRRSFSQIT
GNLMERINDLEKRINNCCQDIGKNDGVLQDQINSFQDQLDFLHKEVGQLRSVQSETLSPD
LVKDLQGLLKLFQTVQEMQEQLKQVHETALELAAEKEDRNYHMNALLEQIELLKTIKLDR
EDMVEAMADKADLRMLARKVSHDQFELACDDLSRGLEHALGKLNIQEALWQQALDDIQRE
IETKLDKMELSPVKDFFNTKLKQLQENLKQMASLRREVEAAGTKRRLLREVNCISCDANA
VMPMEPPNMIPLSRPMPGHMSMKPYLSYELDAIRKTQATNLPQRNLHDWETIDKQMNQQK
QPQKARSDTGKHICNRYCGGSHTMTTAAQRVARAGHFVKQWGPDVVPLSSGLAAGDDGRL
YKVVQNEAANVGPGGAVETTCTPKHPKKTESPKTPTKPVLLAAPECRCLEGG
Download sequence
Identical sequences DPGLEAN01184-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]