SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN01633-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN01633-PA
Domain Number 1 Region: 3-236
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.85e-49
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.016
Further Details:      
 
Weak hits

Sequence:  DPGLEAN01633-PA
Domain Number - Region: 265-320
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0589
Family CRAL/TRIO domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN01633-PA
Sequence length 356
Sequence
MLQNLPCIIKNVSNTWQCSVDWIKEGSINYEYLEQHYGDVVAPVADCQETNFNSHCKTNM
KVGDYITYLRNPSKEKLLYLKDWHLKRLKSGEHFYEVPHIFASDWLNEFAIDHEDDDFMF
VYIGAQNTWTPLHADVYSSYSWSVNVIGRKKWVLFPPGEEEKLKDSLGNLPLLFNAHEFN
NVRYIEVTQERGDAIFVPSGWHHQVCNELETISINHNFVNACNIHFVWEALQRNLISVEN
EIKEFRETPEFTSQCQLILKSLFGMDFESFINFITYIATKRLSLRNNRQYIVFDMYNIGK
NHIDNDLLIIFKIIKCLLNHPLILDSHLPQNIAPTLINIRDQISDIIIKKSPEAKA
Download sequence
Identical sequences DPGLEAN01633-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]