SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN03170-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN03170-PA
Domain Number 1 Region: 15-168
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-38
Family p120GAP domain-like 0.000000585
Further Details:      
 
Domain Number 2 Region: 434-634,686-747,810-907
Classification Level Classification E-value
Superfamily ARM repeat 0.00000115
Family Armadillo repeat 0.077
Further Details:      
 
Domain Number 3 Region: 210-313
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000314
Family CRAL/TRIO domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN03170-PA
Sequence length 1110
Sequence
MLPERNTVLSKRFVQFPQTSVGAVGTVLFLRYINPAIVSPQEMGIVSRPIPAHIKRGLML
MSKILQNIANHVEFSKEQHMLPFNDFLREHFEAGRKFFIEIASDCETVDQTAHNLSFISD
ANVLALHRLLWNHQEKIGDYLSCSRDHKAVGRRPFDKMATLLAYLGPPEHKPVESTSGLL
FSSYARWSSIDMSSTNFEEFIVKHNMHQKEEFKSIKSLNIFYQAGTSKLGNPVFYFISRR
YKISEVNADLLIYHVILTLKPFCQQPFELIVDFTHTNSDNRFRTDFLQKWFTVLPEVAYN
SVHACYIYNCNGWVREYTKFHEIILAPLRVGPTALQITSTEKTKVLGLPVMLNDVYYASE
VDEVCLVDDNQFSLSIINEATPLSFIHNDCDNIVQAIIHIRNRWELSQPDSVTVHQKIRP
KDVPGTLLNMALLNLGSCDPTLRTAAYNQLCALTATFHLKIEGQLLETSGLCIPSNNTIF
IKSVSEKLAHNEPHLTLEFLEECIQGFGKSTIELKHLCLEYMTPWLANLVRFCKPSDESR
RQKQVAGILEKLVTLTIEETQMYPSVQAKIWGSIGQVPELIDMVLDSFLQRSVKSGLGSP
MIEIMADTAVALASANVQLVSRKVIGRMCRALSKLPNNALGPVTPATVVDKTCHSPTAML
EQHMMWADIAILARYLLMLSFNNCLDVIRHLPYLFHTVSFLVYSGSVSMRAATHGLVINI
IHSLCTCNSPSFSEDTQRVLMLSLDEFALPKFYQMFGISKVKSAAVTAFRSPHRHIGDWY
SEHSYSECTVASGCAAGPQAERERLPLQSLETIADALLEIMEACMRDIPDCDWLDTWTSL
AKSFAFCFNPALQPRALIVFGCISKNVTDDDMKQLLRILVKALEVFNDLALLEALIMCLT
RLQPLLHPESPIHAALFWVSLSVLQLDETALYAAGLALMEQNLHTLDSQGAFDNKTLEQV
MMETREPLEWHFKQLDHAVGLSFRSNFHFALVGHLLKGFRHPAAGTVSRTCRVLAALLAL
AARPNRDKFQLTHRTVAYLTALVCVSEEVRSRCHVKHSLPKWLPDNCDHYCPSSDHPQSS
MLIQPTTHSCSGRRKTEEHSTGELGIDMWR
Download sequence
Identical sequences DPGLEAN03170-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]