SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN03841-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN03841-PA
Domain Number 1 Region: 34-270
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.25e-85
Family Calponin-homology domain, CH-domain 0.00000423
Further Details:      
 
Domain Number 2 Region: 289-410
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-34
Family Spectrin repeat 0.0000703
Further Details:      
 
Domain Number 3 Region: 1854-2009
Classification Level Classification E-value
Superfamily Spectrin repeat 3.09e-30
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 4 Region: 1218-1371
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-30
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 5 Region: 1430-1584
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-29
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 6 Region: 1536-1682
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-27
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 7 Region: 627-745
Classification Level Classification E-value
Superfamily Spectrin repeat 3.48e-27
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 8 Region: 1007-1122
Classification Level Classification E-value
Superfamily Spectrin repeat 5.9e-24
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 9 Region: 836-953
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-22
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 10 Region: 374-519
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-20
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 11 Region: 1133-1253
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.00031
Further Details:      
 
Domain Number 12 Region: 1695-1798
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-19
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 13 Region: 522-632
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-18
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 14 Region: 741-836
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-16
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 15 Region: 2013-2074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000327
Family Spectrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN03841-PA
Sequence length 2329
Sequence
MTTDITVSRWDPSVRSGQEIIDEYDGGNSSSRLFERSRIKALADERESVQKKTFQKWVNS
HLVRVGCRINDLNVDMRDGKMLIKLLEVLSGERLPRPTKGKMRIHCLENVDKALQFLREQ
RVHLENMGSHDIVDGNARLNLGLIWTIILRFQIQDITIEETDNKETKSAKDALLLWCQMK
TAGYNNVNVRNFTTSWRDGLAFNAIIHKHRPELIQFEKLHRSNHIHNLNNAFNVAEEKLG
LTKLLDAEDIAVEHPDERSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAMENEKMVQE
YESLTSDLLQWIERTIEALGDRTFANSLEGVRQQLIQFANYRTVEKPPKFVEKGNLEVLL
FTLQSRMRAANQKPYTPREGRMIHDINRAWERLEKAEHERELALREELIRQEKLEQLAAR
FNRKAQMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVQAVVAVCS
ELQAERYHDMERVCARRDNVLRLWAYLLELLRARRARLELSLQLQQNFQEMLYILDSMEE
IKMRLLTDDYGKHLMGVEDLLQKHALVEADINVLGERVKVVVGQSQRFLEQEEGGYRPCD
PAITVERIQQLENAYAELVHLAVERRKRLEDSRKLWQFYWDMADEENWIKEKEQIVSVDD
IGHDLSTVYLLVSKHKALQADVEAHELQLMDAAAVGDELVGQGHFGAARIQERLRDILSQ
WNHLLDVVHLRKNRLDAAVRYHQLFADADDIDFWMLDTLRLVSSEDTGVDEAQVQSLLKK
HKDVTDELKHYANVIQQLKQQAAELSPEDANSTEVQERLAAIDSRHGEIARLRKQRLLDA
LSLFKLLAEADAADQWIAEKHRMLDTMLPPKDIDDVEIMKHRYDGFDKEMNANASRVAVV
NQLARQLVHVEHPQAPRIQERQQALNTAWSALREKAEAKKDDLKSAQGVQTFYIECRETV
SWIEDKKRILQQTDNLEMDLNGVMTLQRRLSGMERDLAAIQARIASLESEASAIENEHPE
EARLIRDRVHAITDNWEDLTQMLKERDSKLEEAGDLHRFLRSVDHFQAWLTKTQTDVASE
DIPASLPEAEKLLSQHQTIKEEIDNYKDEYAKMMEYGEKITAEPSTQDDPQYMFLRERLK
ALREGWAELQQMWENRQQLLTQSLELQLLQRDARQAEVLLAHQEHRLAKTEPPANLEQAE
NMIKENEAFLTTMEANDDKINSVVQFANRLVEERHFDADKIQRKAESIRSRRDANKEKAL
QQMEKLQDQLQLHQFLQDCDELGEWVQEKNVTAQDDTYRSAKTIHSKWTRHQAFEAEIAA
NKERLFAVQNAAEELMKQKPEFVEVISPKMHELQDQFENLQTTTKEKGERLFDANREVLL
HQTCDDIDSWMNELEKQIENTDTGTDLASVNILMQKQQMIETQMAVKAKQVTELETQAEY
LQKTVPDKMEEIKEKKKSVEQRFEQLKAPLLDRQRQLAKKKEAFQFRRDVEDEKLWIHEK
LPVASNTDYGNSLFNVQMLQKKNQSLKTETDNHEPRILTVISNGQKLIDEGHEDAPEFKS
RIEELTARWRELKDAIEQRKNNLSQWEKAQQYLFDANEAEAWMSEQELYMMVEDRGKDEI
SAQNLMKKHEILEQAVDDYAQTIRQLGETVRQLTSEEHPLSEQISVKQSQVDKLYAGLKD
LAGERRAKLDEALRLFQLSREVDDLEQWITERELVASSQELGQDYDHVTLLWERFKEFAR
ETQSVGSERVGTAERIADQMIFMGHSDNATIAQWKESLRETWQDLLELIDTRTQMLAASR
ELHKYFHDCKDTLQRVNEKARGVSEELGRDAISVSALQRKHHNFMQDLSTLQQQVEAIES
ECSRLGASYAGEKAAEITRRAGEVVEAWRALQAACGARREKLEDADQLYRFISMVRDLTL
WMDDVVRSMNTGEKPRDVSGVELLMNNHQSLKAEIETREDKFTACISLGRELLARQHYAS
PDIRDKLLQLTNQRNALLRRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLMSQEL
GHTIDEVESLIKKHEAFEKSAAAQEDRFSALQRLTTLETKAGSLWPKEKPWETYDESSFT
YQPPTCDKIKNRPPALKITDDRPVAEIICEIVHTNDKYKLPEKCGSKRAHGSQTTKPAAK
NDSYLWTVVKNSLSTISEDSTPQRSPLKTPLSPEIYSSIFFEYNYENEKSDDRLACVDLI
LWERLSYLGVYPNVSLLRRRSTSSSKSGSRKSLWKRLSWKRKSCEGDNSSDIAVLSLPGL
TSSTRDINDLGNEIKSIPLTSSLLLLSQTRSLLFPEGDWYYNYMDSVSV
Download sequence
Identical sequences DPGLEAN03841-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]