SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN04250-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN04250-PA
Domain Number 1 Region: 11-232
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.92e-17
Family Reverse transcriptase 0.011
Further Details:      
 
Domain Number 2 Region: 432-585
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.18e-16
Family CRAL/TRIO domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN04250-PA
Sequence length 601
Sequence
MPHQWRYSYITPIYKGRGSVQDCGSYRGVKIMSHTMKLFERMIDLRLRRECTVSECQYGF
QPGSGTLDAIFAIRTLMEAYREKRRALHVAFLDLQKAFDCVPRQCIWWALRFKGIPEAYI
DIIRDMYRDSVSMVRTAVGDTKPFPISVGLHQGSALSPFLFNVVLDTVSANIQDQPPWLM
MYADDIALIDESRLTLERRVNLWKGTLENGGLKLNVTKTEYMACGSPDSCTIHIGPEPAV
KSEKFRYLGSILHESGGIDHDVQARISAAWAKWRDVTGVVCDRRIPTKLKGIIYKSIIRP
VLLYGSECWPTLSRHTQELHVTEMKMLRWMCGVTRADRIRNTFIRGSLGVRDVADKLQES
RLRWYGHVARRPENYVGKICLDMSVPGARPPGRPRKRWLDTVKQDMRANGLTTADAKDRA
KYERLLRRARSEDLSEVSGIGCLYQSGVDRLGRPVVVFIGKWFPITEIDLDKALLYLIKL
LDPIVRGDYVIAYFHTLASSNNHPPFSWLKEVYTDDGIFIPYKKNLKAFYIVHPTFWTKM
MTWWFTTFMAPAIKAKVHTLPGVEYLYSVMARDQLLHGRKQCLYDMTINGLHYFQPDTSN
T
Download sequence
Identical sequences DPGLEAN04250-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]