SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN05688-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN05688-PA
Domain Number 1 Region: 337-460
Classification Level Classification E-value
Superfamily PH domain-like 6.44e-27
Family Pleckstrin-homology domain (PH domain) 0.00077
Further Details:      
 
Domain Number 2 Region: 13-149
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-20
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 611-682
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.57e-16
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.012
Further Details:      
 
Domain Number 4 Region: 126-218
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000563
Family Spectrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN05688-PA
Sequence length 701
Sequence
MWAVVQRPGLGEAFPDAKEHVLSKLEEVTEALEALEEKAAHSEHQLELADQLKAYFDKYQ
ELMAWNNETLARVTAPELSSDVAGAARLLARHQDLAAEIHAKDESFQTFYDDGEKLVREG
HFMSQEVETRMSSLRARRAALDHAWSARNRIYEHHLDALMFLRDADALDRWISSRVPLVR
DGKYGESLAQTEELINRHRDLEETIDAQKEKFLALKRITLIEKAFKDQKNEEEAARKQHL
ERQEAERMQLVRKREMERIAEERRRETEEQRGTAVQVERQLSSSGMNSSLAGSVEETLSP
APQFDRLPKPDVHVKRAESMSVVKTPKRTPSFTTRRRTQSFRRHRKHDDLPPVEIEGYLE
RKQEAGSGGVRAAVRSWRSYYAVLCGQLLCFFRDQEDFASSKAAAPPVAILNARCTPASD
YTKRSHVFRLSCADGAEYLFSCGSRDLLAEWVAKLAFHAALPPQLQLTPYNAEESPTADV
RRRLQQNASSSSSAASSPEPQRHRTQAEILQEHRTSQKESQAGREDNKSRVSADRHIEST
VLPSLPPRQPPAVDDTADVVLRNSDRESHSWGRSRFSNGRDLNAEFIRSQRDGNDIDTHH
HTTWSGGSPPHNAGFDATNLLNKLRQKHHQGEPWYGVDIQKEDIADNFEACVWEPAVVKI
NAITAACEAAAQILSIDETIKNAKSGEPQMPGRGMGRPRMG
Download sequence
Identical sequences DPGLEAN05688-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]