SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN08018-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  DPGLEAN08018-PA
Domain Number - Region: 1089-1244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0259
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN08018-PA
Sequence length 1339
Sequence
MGRPDGNEPITLQSNADKDVLQRDVECHRRIVSSVVRLCGGADVARALERRWHLLYLRAI
EWLCHLEACIAKSDNQNCASIEVASDSDDEPALKQPRLTRRGSPRRQRTPINVIRRSSSE
DSRQSASEEEQEYAVTYTWRGFGSDCETELVRDRDCEMDERRVPTVDEGEDRQTDQTVPG
GDNVDGISVRETGRLEDIPREMNTPPTVVKRKKPVNTSKFNQSDRKSKNCATFYFRHHDT
DSDRQVVETDEKSQEESSEEEWTYVDGPKIANEDSTDLMTSSIEIQCDLPVDDKKEKLLS
PKKLESTTPDLIRVDQNSRCKDLERLVLQAEELVQKQAQQQMAKKKNTRNLKPLSFDEEG
KSSREKMSRIKEWLNQSPEDKNDSNQCTESYDASGEYTTESEVDTSLTSEERNIHSSMDM
STSTCTVTPTHHAKVTLRKKRNATRPWSVSCLSQLSAGIIATPTDDVINMSISESALNTL
ASPRRVTPGNSSSKLRGSSTTVQGHISSTNTMTEACTSCVEANDKQCWLRRKRLKLKRQN
NTRRERLVKSLSFCGRLSPEIEDKNERSAASDPATSRKNRFDTTSTSDNDSDADLIKQQL
ATIANLRKSIEKTHISSKEQDSAIPEQNETELVGPSFKLGPEGGTVRPRMTKSMERERTF
LALSLGDPSQMWDLSVDKDSESITAGTEGHSSFSEQAWDFYQEKYNSEPYSEAPDSDAAR
RLLEFGDDYRAFLDSQSDCCSSLSAHPDDTSPTTRRRRPPSDTRERSLPRYKRPTRTSPV
ETPSRKPKKSMSSAERKKTLLDSLERSRNNTSIESNEGVRRRKQSENERKNSKRSPDFDL
LNVQALSRRRHSSNLTSDEINSSLEYTEVNNRPDILDSLNRRRKEKEGGTELQKIALSEL
RRRSTGSADSEGESSSPKHSRKNWGDSDSEADEVKSLVRRSSTQLEVTEALLARHDSSPD
ILRAFDYTEVVTRCRDNINLLEVALSEASLSPTLQKEIRAVSARWSALRAAAIRRGGARR
LRREIGALKETLDDICEPGDYAPQPHTRAQLHKRIEELKERLSRLLECKVSMLKLTVSVR
RALGEMETDDSGLTTELTSLIAAWDDAHQRTSTELLSLEKAVSAWAEWERALRELQAALR
GDLAALEALRDRPDCDELASHVRHLAAALFDKKKGGSTCDSLSDSGISDGDSEGAGRARR
LTALRELARRLQAVLAPNSPAHRAIAKRMEQTENEVKILQESCRALVEQSIPDLKIDEVT
RDHTIAVSSKKTGAGDPDYNPRSGWVWRVLRSSIPIQLCLVALLLAAWLVERPRCCDALN
SLAQTLTPQLRYVRGPPPV
Download sequence
Identical sequences A0A212F7S8
DPGLEAN08018-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]