SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN08625-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN08625-PA
Domain Number 1 Region: 99-270
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.57e-30
Family CRAL/TRIO domain 0.00079
Further Details:      
 
Weak hits

Sequence:  DPGLEAN08625-PA
Domain Number - Region: 11-135
Classification Level Classification E-value
Superfamily EF-hand 0.0249
Family Parvalbumin 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN08625-PA
Sequence length 303
Sequence
MPSKVIEQRPLDEEYEKTGVSPSDIAALRQWLKTQPHLPDKYITDMELILAYHSCYKSSE
VSKQVIDLHYTLRTLFTNLFHNRLVDDSFIRTMNVILGFPIETRTSKDYKVVYFRLIDYD
AKNFIFSEAVRAAIMLIDLMQYEDGAWKGFVIIIDLNRVTLGHIARLDLQTIQQLLYYLQ
EAMLVRLKGLHFLNAPSFMDRLMMLLRPFMKKELMEMLKIHQVGATTLEETIPIDALPKE
AGGKSNSFQEIKNEIIDKLIANKNFFVDENKRRVTESLRPGKPKTITDIFGGIEGSFKKL
DID
Download sequence
Identical sequences A0A212F272
DPGLEAN08625-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]