SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN08660-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN08660-PA
Domain Number 1 Region: 162-337
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.14e-27
Family CRAL/TRIO domain 0.0016
Further Details:      
 
Weak hits

Sequence:  DPGLEAN08660-PA
Domain Number - Region: 79-152
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000275
Family CRAL/TRIO N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN08660-PA
Sequence length 372
Sequence
MDIPNVDVADALQGGVGIRKWRERVGIGKGQPAIALIGRNAAAKGYFTATFCERVILPRS
SRPMFELVTMSGVIQQFPAEKEYEKNPDISPEDIRKLREWMKTQPHLPEQHWTDLDLIIA
YHCCECSTEVAKQVIDLHISSRTLLKELFHDRVIDKRIIDTLHVALLAPLPTPTVHGYRA
MYCRLLDGDYRKYNLTDMVRTFMAVFDLWQYEEGTWPGFVIIIDMDLVSVSHVTKLDVTT
IRNTLYFLQECMLAKVKEVHFTNAPPFMDRVLMLLKPFIANDLIHILHVHEKKSDVLFEY
VPKESFPEECGGNYMKLESLRDLHIRRLQDNKEFFVRENLRRVDESLRPNGKTKTIEDVF
GIQGSFKKLDID
Download sequence
Identical sequences DPGLEAN08660-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]