SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN10482-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN10482-PA
Domain Number 1 Region: 3-185
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-69
Family Calponin-homology domain, CH-domain 0.0000209
Further Details:      
 
Domain Number 2 Region: 227-350
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-33
Family Spectrin repeat 0.00000209
Further Details:      
 
Domain Number 3 Region: 464-584
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-25
Family Spectrin repeat 0.0000159
Further Details:      
 
Domain Number 4 Region: 351-460
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-22
Family Spectrin repeat 0.00000917
Further Details:      
 
Domain Number 5 Region: 588-700
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-21
Family Spectrin repeat 0.0000163
Further Details:      
 
Domain Number 6 Region: 693-824
Classification Level Classification E-value
Superfamily EF-hand 2.09e-20
Family EF-hand modules in multidomain proteins 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN10482-PA
Sequence length 853
Sequence
MLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLG
MIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHR
HRPDLIDYSKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCY
YHAFQGAQQNTAMPDERAVMTYVSSYYHCFSGAQKAETAANRICKVLKVNQENERLMEEY
ERLASDLLDWIRRTMPWLNSRQTDNSLAGCQKKLEDYRTYRRKHKPPRVEQKAKLETNFN
TLQTKLRLSNRPAYMPTEGKMVSDIAQAWKGLEIAEKAFEEWLLSEMMRLERLEYLAQKF
KHKADIHEDWTRGKEEMLQSQDFRQCKLYDIKALKKKHEAFESDLAAHQDRVEQIAAIAQ
ELNTLEYHEVGAVNARCQRICSQWDRLGALTQRRRAALDDAERLLEQIDLLHLEFAKRAA
PFNNWLDGTREDLVDMFIVHTIEEISGLMDAHARFKATLGEADKEYQAIVNLVHQVESIV
KQHQIPGGLENPYTTLTAHELNRKWSDVRQLVPQRDSTLAAELRKQQNNETLRRQFAEKA
NAVGPWIERQMDAVTAIGMGLQGSLEDQLHRLKEYEAGVYAYKPHIEELERIHQAVQEGM
IFENRYSQYTMETLRVGWEQLLTSINRTINEVENQILTRDSKGITQEQLTEFRASFNHFD
KNRTGRLAPEELKSCLVSLGYSIGKDRQGELDFQRILAVVDPNNTGYVSFDAFLDFMTRE
STDTDTAEQVIDSFRILAGDKPYITADELRRELPPDQAEYCVARMPPYRGPNAPPHALDY
MAFSTALYGETDL
Download sequence
Identical sequences DPGLEAN10482-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]